<?xml version="1.0" encoding="UTF-8"?><rss xmlns:dc="http://purl.org/dc/elements/1.1/" xmlns:content="http://purl.org/rss/1.0/modules/content/" xmlns:atom="http://www.w3.org/2005/Atom" version="2.0"><channel><title><![CDATA[CoderWatch]]></title><description><![CDATA[Just an Average Coder.]]></description><link>https://coderwatch.com</link><generator>RSS for Node</generator><lastBuildDate>Tue, 21 Apr 2026 19:03:24 GMT</lastBuildDate><atom:link href="https://coderwatch.com/rss.xml" rel="self" type="application/rss+xml"/><language><![CDATA[en]]></language><ttl>60</ttl><item><title><![CDATA[Fundamentals of Cybersecurity for Security Enthusiasts]]></title><description><![CDATA[What is Cybersecurity?
Cybersecurity provides developers ways to secure data and the internet for others. It defines processes, practices, programs, laws, and devices that are used to preserve the fundamental rule of security. As we move towards secu...]]></description><link>https://coderwatch.com/fundamentals-of-cybersecurity-for-security-enthusiasts</link><guid isPermaLink="true">https://coderwatch.com/fundamentals-of-cybersecurity-for-security-enthusiasts</guid><category><![CDATA[Open Source]]></category><category><![CDATA[Security]]></category><category><![CDATA[#cybersecurity]]></category><category><![CDATA[encryption]]></category><dc:creator><![CDATA[Coder Watch]]></dc:creator><pubDate>Thu, 26 Aug 2021 20:35:20 GMT</pubDate><enclosure url="https://cdn.hashnode.com/res/hashnode/image/upload/v1630009359513/sC0tpVVEQ.jpeg" length="0" type="image/jpeg"/><content:encoded><![CDATA[<h2 id="what-is-cybersecurity">What is Cybersecurity?</h2>
<p>Cybersecurity provides developers ways to secure data and the internet for others. It defines processes, practices, programs, laws, and devices that are used to preserve the fundamental rule of security. As we move towards securing personal information, the amount of intellectual property and essential information has expanded at the same rate as its use.</p>
<p>There is a fundamental need to protect user data and the organization's cybersecurity infrastructure. For this, different assets are subject to various testing methods, just as network devices and web applications are subject to application security.</p>
<h2 id="understanding-basic-terminology">Understanding Basic Terminology</h2>
<ol>
<li><p><strong>Vulnerability</strong>: Vulnerabilities are the "weaknesses" in the system, using which an attacker can compromise the system or the whole network. By identifying, categorizing, remediating, and mitigating vulnerabilities, the security team can manage the vulnerability.</p>
</li>
<li><p><strong>Exploit</strong>: Exploits are codes that take advantage of a system flaw. We can have exploits that automatically exploit a vulnerability; nothing else is needed. </p>
</li>
<li><p><strong>Payload</strong>: A payload is a real message or part of a communication containing malware, a virus, or a worm. Payloads are used to remove data, encrypt data, or spam.</p>
</li>
<li><p><strong>Firewall</strong>: Firewalls are devices that monitor the inbound/outbound filter traffic so that illegal network access is prevented and harmful data packets are prevented from entering the network.</p>
</li>
<li><p><strong>Intrusion prevention system/intrusion detection system</strong>: These devices are used to identify threats based on their signatures and prevent identified threats. The administrator can construct their own signature and work on the created signature.</p>
</li>
</ol>
<h2 id="cybersecurity-strategies">Cybersecurity Strategies</h2>
<p>Let's talk about different strategies for protecting users' online identities.</p>
<h3 id="1-two-factor-authentication">1. Two-Factor Authentication</h3>
<p>2FA provides an additional level of safety by authenticating users from details other than just their username and password. Thus, the user must first input their username and password in the first layer of authentication. Then, they must enter a token in the second layer. This token can be sent by email, <a target="_blank" href="https://play.google.com/store/apps/details?id=com.google.android.apps.authenticator2&amp;hl=en_US&amp;gl=US">Google authenticator</a>, SMS, or RSA token. </p>
<p><img src="https://lh6.googleusercontent.com/iR4-yHuM6riIwSV5CBib0-qn_nIJwhcQIe1EAEZTPrZ-1sYk388pToqwbRBMajrpdqJiVIyBVuD4zGYAxPJDEKV2DFlMqq0BUXo0gvWFTCRvGAQRVmRkSNMk1RlzQ5yHMuaRymkM=s0" alt /></p>
<p><a target="_blank" href="https://www.nist.gov/itl/applied-cybersecurity/tig/back-basics-multi-factor-authentication">Source</a></p>
<p><strong>Note</strong>: A business normally sets the second level of authentication to prevent unauthorized access to the account. So, it depends upon the company to choose what technology they want to utilize for user authorization, such as OTP, Smart Cards, etc.</p>
<h3 id="2-data-encryption">2. Data Encryption</h3>
<p><a target="_blank" href="https://www.cloudflare.com/en-in/learning/ssl/what-is-encryption/">Encryption</a> the data during rest and motion because it prevents attackers from obtaining information if the system is compromised. As the data is encrypted and decrypted every time it is accessed, the attacker needs the key, which is practically impossible to obtain.</p>
<h2 id="3-updating-software-regularly">3. Updating Software Regularly</h2>
<p>Admin must always keep updated versions of the software that is being used, including servers, antiviruses, operating systems, and browsers. An attacker may leverage a vulnerability in outdated software to exploit your network.</p>
<h3 id="4-password-managers">4. Password Managers</h3>
<p>You can use <a target="_blank" href="https://www.pcmag.com/picks/the-best-password-managers">password managers</a> that generate strong passwords and can safely store them so that an attacker cannot steal them or break them.</p>
<h2 id="do-it-yourself-cybersecurity-practices">Do-It-Yourself Cybersecurity Practices</h2>
<ol>
<li><p>Do not use public Wi-Fi or unprotected networks unless absolutely unnecessary and please be careful when you connect.</p>
</li>
<li><p>Keep changing passwords and adopt a powerful network password policy.</p>
</li>
<li><p>Regularly back up your data so you can check or replace compromised data on the server with old data if some harmful behavior occurs.</p>
</li>
<li><p>Provide personnel training for employees to secure your company from <a target="_blank" href="https://www.webroot.com/us/en/resources/tips-articles/what-is-social-engineering">social engineering</a> attacks.</p>
</li>
</ol>
<h2 id="an-important-resource-the-owasp-top-10">An Important Resource: The OWASP Top 10</h2>
<p><img src="https://lh3.googleusercontent.com/US0FT7-6l3jiKoS_eywSWzF-2teWx75tQwabxwb4QtqAfFz05rCwHRj6tAogmdTzfdfW-oTtOLyDY_tS4pydPf4iNTQfiaOtl5PVWFvfC7dJJ7cAbvE4ESvf5YCZKU7WJbh8RQSi=s0" alt /></p>
<p>The Open Web Application Security Project (OWASP) is an online community that produces freely available methodologies, tools, articles, and documents related to cybersecurity. It has different types of categories, such as mobile web applications and API tests. Many projects have been started by this community, such as Vulnerable Applications, on which you can test the vulnerabilities.</p>
<p>OWASP puts out an <a target="_blank" href="https://www.perforce.com/blog/kw/what-is-owasp-top-10">OWASP Top 10</a> list of vulnerabilities in softwares. For example, they have listed injection, broken authentication, etc., on their list for web applications.</p>
<p>OWASP provides excellent examples of these vulnerabilities and their remedies. Security engineers, information security analysts, and other IT teams can utilize this to detect and address vulnerabilities by following the list. In fact, it operates as the gold standard in cybersecurity.</p>
<p>Cybersecurity beginners can follow the OWASP Top 10 and the OWASP testing guide to learn more about cybersecurity and penetration testing. They also have a <a target="_blank" href="https://cheatsheetseries.owasp.org/">cheat sheet</a> that defines lots of vulnerabilities and how to remediate them in easy and understandable language so that a beginner can read and start their career in cybersecurity.</p>
<h2 id="conclusion">Conclusion</h2>
<p>Cybersecurity is now a requirement in every organization. Most companies are now dealing with user data. As this data is not their own, they have to ensure it is well protected to retain the trust of their users and not face penalties from the countries in which they operate. Thus, it is essential to secure the identity of users.</p>
<p>Users should also have some fundamental knowledge about cybersecurity terminology and methods. Organizations can easily follow security standards such as OWASP to secure their user data and improve the security of their organization.</p>
<p>Cover Photo by <a target="_blank" href="https://unsplash.com/@markusspiske?utm_source=unsplash&amp;utm_medium=referral&amp;utm_content=creditCopyText">Markus Spiske</a> on <a target="_blank" href="https://unsplash.com/s/photos/cybersecurity?utm_source=unsplash&amp;utm_medium=referral&amp;utm_content=creditCopyText">Unsplash</a></p>
]]></content:encoded></item><item><title><![CDATA[20 Amazing JavaScript shorthands for ultimate productivity in 2021]]></title><description><![CDATA[Saving time is the necessary thing for developers when working on projects. I am sharing 20 JavaScript shorthands which you can use to save you time while coding. 

Declaring variables
You can easily declare/define multiple variables on one line. 
//...]]></description><link>https://coderwatch.com/js-shorthands-productivity</link><guid isPermaLink="true">https://coderwatch.com/js-shorthands-productivity</guid><category><![CDATA[General Advice]]></category><category><![CDATA[Web Development]]></category><category><![CDATA[Productivity]]></category><category><![CDATA[JavaScript]]></category><dc:creator><![CDATA[Coder Watch]]></dc:creator><pubDate>Wed, 04 Aug 2021 04:11:52 GMT</pubDate><enclosure url="https://cdn.hashnode.com/res/hashnode/image/upload/v1627653075237/-EBGQ8H4G.png" length="0" type="image/jpeg"/><content:encoded><![CDATA[<p>Saving time is the necessary thing for developers when working on projects. I am sharing 20 JavaScript shorthands which you can use to save you time while coding. </p>
<hr />
<h3 id="declaring-variables">Declaring variables</h3>
<p>You can easily declare/define multiple variables on one line. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">//Long version  </span>
<span class="hljs-keyword">let</span> a;   
<span class="hljs-keyword">let</span> b = <span class="hljs-number">1</span>; 

<span class="hljs-comment">//Shorthand  </span>
<span class="hljs-keyword">let</span> a, b = <span class="hljs-number">1</span>;
</code></pre>
<h3 id="assigning-values-to-multiple-variables">Assigning values to multiple variables</h3>
<p>You can assign values to multiple variables with array destructuring. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">//Long version  </span>
x = <span class="hljs-number">1</span>;   
y = <span class="hljs-number">2</span>;   
z = <span class="hljs-number">3</span>; 

<span class="hljs-comment">//Shorthand  </span>
<span class="hljs-keyword">let</span> [x, y, z] = [<span class="hljs-number">1</span>, <span class="hljs-number">2</span>, <span class="hljs-number">3</span>];
</code></pre>
<h3 id="assigning-default-value">Assigning default value</h3>
<p>You can set default values with the <code>|| (OR)</code> operator. If the value onn the left side is falsy it will use the one on the right. </p>
<pre><code class="lang-javascript"><span class="hljs-keyword">let</span> finalName;   
<span class="hljs-keyword">let</span> name = getName();   
<span class="hljs-keyword">if</span>(name !== <span class="hljs-literal">null</span> &amp;&amp; name !== <span class="hljs-literal">undefined</span> &amp;&amp; name !== <span class="hljs-string">''</span>) {  
    finalName = name;   
} <span class="hljs-keyword">else</span> {  
    finalName = <span class="hljs-string">'Rahul'</span>  
}

<span class="hljs-comment">// Shorthand  </span>
<span class="hljs-keyword">let</span> finalName = getName() || <span class="hljs-string">'Rahul'</span>;
</code></pre>
<h3 id="the-ternary-operator">The ternary operator</h3>
<p>You can write <em>if else</em> statements in one line using the ternary (<code>?:</code>) operator. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">//Long version  </span>
<span class="hljs-keyword">let</span> points = <span class="hljs-number">70</span>;   
<span class="hljs-keyword">let</span> result;   
<span class="hljs-keyword">if</span>(marks &gt;= <span class="hljs-number">50</span>){  
    result = <span class="hljs-string">'Pass'</span>;   
}<span class="hljs-keyword">else</span>{  
    result = <span class="hljs-string">'Fail'</span>;   
}

<span class="hljs-comment">//Shorthand  </span>
<span class="hljs-keyword">let</span> points = <span class="hljs-number">70</span>;   
<span class="hljs-keyword">let</span> result = marks &gt;= <span class="hljs-number">50</span> ? <span class="hljs-string">'Pass'</span> : <span class="hljs-string">'Fail'</span>;
</code></pre>
<h3 id="template-literals">Template Literals</h3>
<p>Instead os using the + operator to concatenate strings we can use ES6 template literals. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">// Long version  </span>
<span class="hljs-built_in">console</span>.log(<span class="hljs-string">'Hello '</span> + name +<span class="hljs-string">', it is '</span> + day); 

<span class="hljs-comment">//Shorthand  </span>
<span class="hljs-built_in">console</span>.log(<span class="hljs-string">`Hello <span class="hljs-subst">${name}</span>, it is <span class="hljs-subst">${day}</span>`</span>);
</code></pre>
<h3 id="swap-two-variables">Swap two variables</h3>
<p>With arraw destructuring you can swap two variables without using a third one. </p>
<pre><code class="lang-javascript"><span class="hljs-keyword">let</span> x = <span class="hljs-number">1</span>, y = <span class="hljs-number">2</span>;   
<span class="hljs-comment">//Long version  </span>
<span class="hljs-keyword">const</span> temp = x;   
x = y;   
y = temp; 

<span class="hljs-comment">//Shorthand  </span>
[x, y] = [y, x];
</code></pre>
<h3 id="andand-short-circuit-evaluation">AND(&amp;&amp;) Short circuit evaluation</h3>
<p>You can use the <code>&amp;&amp;</code> operator if you want to execute a function if a variable is true. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">// Long version  </span>
<span class="hljs-keyword">if</span> (isLoggedin) {   
    redirectToHomepage();   
}

<span class="hljs-comment">//Shorthand  </span>
isLoggedin &amp;&amp; redirectToHomepage();
</code></pre>
<h3 id="arrow-function">Arrow function</h3>
<p>You can write shorter functions using the arrow function syntax. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">//Long version  </span>
<span class="hljs-function"><span class="hljs-keyword">function</span> <span class="hljs-title">add</span>(<span class="hljs-params">a, b</span>) </span>{  
    <span class="hljs-keyword">return</span> a + b;   
}

<span class="hljs-comment">// Shorthand  </span>
<span class="hljs-keyword">const</span> add = <span class="hljs-function">(<span class="hljs-params">a, b</span>) =&gt;</span> a + b;
</code></pre>
<h3 id="multi-line-string">Multi-line string</h3>
<p>For multiline string instead of using + operator with a new line ecape sequence (\n). We can use usebackticks(``). </p>
<pre><code class="lang-javascript"><span class="hljs-comment">// Long version  </span>
<span class="hljs-built_in">console</span>.log(<span class="hljs-string">'A blog is a discussion or informational website published\n'</span> + <span class="hljs-string">'on the World Wide Web consisting of discrete, often informal diary-style text entries. Posts are typically\n'</span> + <span class="hljs-string">'displayed in reverse chronological order, so that the most recent post\n'</span> + <span class="hljs-string">'appears first, at the top of the web page. Until 2009,\n'</span> + <span class="hljs-string">'blogs were usually the work of a single'</span> ); 

<span class="hljs-comment">//Shorthand  </span>
<span class="hljs-built_in">console</span>.log(<span class="hljs-string">`A blog is a discussion or informational website published on the World Wide Web consisting of discrete, often informal diary-style text entries . Posts are typically displayed in reverse chronological order, so that the most recent post appears first, at the top of the web page. Until 2009, blogs were usually the work of a single`</span>);
</code></pre>
<h3 id="multiple-condition-checking">Multiple condition checking</h3>
<p>When checking for multiple values, we can pull all values in an array and use <code>indexOf()</code> / <code>includes()</code> method. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">//Long version  </span>
<span class="hljs-keyword">if</span> (value === <span class="hljs-number">1</span> || value === <span class="hljs-string">'one'</span> || value === <span class="hljs-number">2</span> || value === <span class="hljs-string">'two'</span>) {  
    <span class="hljs-comment">//Execute code  </span>
}

<span class="hljs-comment">//Shorthand 1  </span>
<span class="hljs-keyword">if</span> ([<span class="hljs-number">1</span>, <span class="hljs-string">'one'</span>, <span class="hljs-number">2</span>, <span class="hljs-string">'two'</span>].indexOf(value) &gt;= <span class="hljs-number">0</span>) {  
    <span class="hljs-comment">//Execute code  </span>
}  
<span class="hljs-comment">//Shorthand 2  </span>
<span class="hljs-keyword">if</span> ([<span class="hljs-number">1</span>, <span class="hljs-string">'one'</span>, <span class="hljs-number">2</span>, <span class="hljs-string">'two'</span>].includes(value)) {  
    <span class="hljs-comment">//Execute code  </span>
}
</code></pre>
<h3 id="string-into-a-number">String into a number</h3>
<p>You can convert a string to a number by writing a + operator before the string. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">// Long version  </span>
<span class="hljs-keyword">let</span> total = <span class="hljs-built_in">parseInt</span>(<span class="hljs-string">'45'</span>);   
<span class="hljs-keyword">let</span> average = <span class="hljs-built_in">parseFloat</span>(<span class="hljs-string">'421.6'</span>); 

<span class="hljs-comment">//Shorthand  </span>
<span class="hljs-keyword">let</span> total = +<span class="hljs-string">'45'</span>;   
<span class="hljs-keyword">let</span> average = +<span class="hljs-string">'421.6'</span>;
</code></pre>
<h3 id="object-property-assignment">Object property Assignment</h3>
<p>If the variable name and object key name is the same, then we can just mention variable name in object literals instead of both key and value. </p>
<pre><code class="lang-javascript"><span class="hljs-keyword">let</span> firstname = <span class="hljs-string">'Emma'</span>;   
<span class="hljs-keyword">let</span> lastname = <span class="hljs-string">'Turner'</span>;   
<span class="hljs-comment">//Long version  </span>
<span class="hljs-keyword">let</span> obj = {<span class="hljs-attr">firstname</span>: firstname, <span class="hljs-attr">lastname</span>: lastname}; 

<span class="hljs-comment">//shorthand  </span>
<span class="hljs-keyword">let</span> obj = {firstname, lastname};
</code></pre>
<h3 id="find-max-and-min-numbe-rin-array">Find max and min numbe rin array</h3>
<p>Instead of writing  a for loop you cna use the spread operator of <code>Array.reduce()</code>. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">// Shorthand  </span>
<span class="hljs-keyword">const</span> arr = [<span class="hljs-number">2</span>, <span class="hljs-number">8</span>, <span class="hljs-number">15</span>, <span class="hljs-number">4</span>];   
<span class="hljs-built_in">Math</span>.max(...arr); <span class="hljs-comment">// 15  </span>
<span class="hljs-built_in">Math</span>.min(...arr); <span class="hljs-comment">// 2</span>
</code></pre>
<h3 id="exponent-power">Exponent Power</h3>
<p>Instead of <code>Math.pow()</code> we can use ** to find the power of a number. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">//Long version  </span>
<span class="hljs-keyword">const</span> power = <span class="hljs-built_in">Math</span>.pow(<span class="hljs-number">4</span>, <span class="hljs-number">3</span>); <span class="hljs-comment">// 64</span>

<span class="hljs-comment">//Shorthand  </span>
<span class="hljs-keyword">const</span> power = <span class="hljs-number">4</span>**<span class="hljs-number">3</span>; <span class="hljs-comment">// 64</span>
</code></pre>
<h3 id="doouble-not-bitwise-operator">Doouble NOT bitwise operator</h3>
<p>You can use the <code>~~</code> instead of <code>Math.floor()</code>. Only works for 32-bit numbers, so use it wisely. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">//Long version  </span>
<span class="hljs-keyword">const</span> floor = <span class="hljs-built_in">Math</span>.floor(<span class="hljs-number">4.8</span>); <span class="hljs-comment">// 4</span>

<span class="hljs-comment">//Shorthand  </span>
<span class="hljs-keyword">const</span> floor = ~~<span class="hljs-number">4.8</span>; <span class="hljs-comment">// 4</span>
</code></pre>
<h3 id="repeat-a-string-multiple-time">Repeat a string multiple time</h3>
<p>Instead of a <em>for loop</em> you can use the <code>repeat()</code> stringmethod to repeat a string. </p>
<pre><code class="lang-javascript"><span class="hljs-comment">//Long version  </span>
<span class="hljs-keyword">let</span> str = <span class="hljs-string">''</span>;   
<span class="hljs-keyword">for</span>(<span class="hljs-keyword">let</span> i = <span class="hljs-number">0</span>; i &lt; <span class="hljs-number">5</span>; i ++) {  
    str += <span class="hljs-string">'Hello '</span>;   
}  
<span class="hljs-built_in">console</span>.log(str); <span class="hljs-comment">// Hello Hello Hello Hello Hello </span>

<span class="hljs-comment">//Shorthand  </span>
<span class="hljs-string">'Hello '</span>.repeat(<span class="hljs-number">5</span>);
</code></pre>
<h3 id="for-loop">For loop</h3>
<p>We can use the <strong>for of</strong> or <strong>for in</strong> instead of a for loop. </p>
<pre><code class="lang-javascript"><span class="hljs-keyword">let</span> arr = [<span class="hljs-number">1</span>, <span class="hljs-number">2</span>, <span class="hljs-number">3</span>, <span class="hljs-number">4</span>];   
<span class="hljs-comment">//Long version  </span>
<span class="hljs-keyword">for</span> (<span class="hljs-keyword">let</span> i = <span class="hljs-number">0</span>; <span class="hljs-number">1</span> &lt; arr.length; i++) {  
    <span class="hljs-built_in">console</span>.log(arr[i]);   
}  
<span class="hljs-comment">//Shorthand  </span>
<span class="hljs-comment">//for of loop  </span>
<span class="hljs-keyword">for</span> (<span class="hljs-keyword">const</span> val <span class="hljs-keyword">of</span> arr) {  
    <span class="hljs-built_in">console</span>.log(val);   
}  
<span class="hljs-comment">//for in loop  </span>
<span class="hljs-keyword">for</span> (<span class="hljs-keyword">const</span> index <span class="hljs-keyword">in</span> arr) {  
    <span class="hljs-built_in">console</span>.log(arr[index]);  
}
</code></pre>
<h3 id="deep-clong-of-multi-level-object">Deep clong of multi-level object</h3>
<p>It won't work when you have functions as values, but otherwise feel free to use it. </p>
<pre><code class="lang-javascript"><span class="hljs-keyword">let</span> obj = {<span class="hljs-attr">x</span>: <span class="hljs-number">20</span>, <span class="hljs-attr">y</span>: {<span class="hljs-attr">z</span>: <span class="hljs-number">30</span>}}; 

<span class="hljs-comment">//long version  </span>
<span class="hljs-keyword">const</span> makeDeepClone = <span class="hljs-function">(<span class="hljs-params">obj</span>) =&gt;</span> {  
    <span class="hljs-keyword">let</span> newObject = {};   
    <span class="hljs-built_in">Object</span>.keys(obj).map(<span class="hljs-function"><span class="hljs-params">key</span> =&gt;</span> {  
        <span class="hljs-keyword">if</span>(<span class="hljs-keyword">typeof</span> obj[key] === <span class="hljs-string">'object'</span>){  
            newObject[key] = make DeepClone(obj[key]);   
        } <span class="hljs-keyword">else</span> {  
            newObject[key] = obj[key];   
        }  
    });   
    <span class="hljs-keyword">return</span> neObject;   
}  
<span class="hljs-keyword">const</span> cloneObj = makeDeepClone(obj); 

<span class="hljs-comment">//Shorthand  </span>
<span class="hljs-keyword">const</span> cloneObj = <span class="hljs-built_in">JSON</span>.parse(<span class="hljs-built_in">JSON</span>.stringify(obj));
</code></pre>
<h3 id="get-character-from-string">Get character from string</h3>
<p>You can use <code>[]</code> operator to get a character from a string. </p>
<pre><code class="lang-javascript"><span class="hljs-keyword">let</span> str = <span class="hljs-string">'heelloworld'</span>;   
<span class="hljs-comment">//Long version  </span>
str.charAt(<span class="hljs-number">1</span>); <span class="hljs-comment">// e</span>

<span class="hljs-comment">//Shorthand  </span>
str[<span class="hljs-number">1</span>]; <span class="hljs-comment">// e</span>
</code></pre>
<h3 id="merging-arrays">Merging arrays</h3>
<p>Instead of using <code>Array.concat()</code> we can use the rest operator to merge arrays. </p>
<pre><code class="lang-javascript"><span class="hljs-keyword">let</span> arr1 = [<span class="hljs-number">2</span>, <span class="hljs-number">3</span>];   
<span class="hljs-comment">//Long version  </span>
<span class="hljs-keyword">let</span> arr2 = arr1.concat([<span class="hljs-number">4</span>, <span class="hljs-number">5</span>]);   
<span class="hljs-comment">// [2, 3, 4, 5]</span>

<span class="hljs-comment">// Shorthand  </span>
<span class="hljs-keyword">let</span> arr2 = [...arr1, <span class="hljs-number">4</span>, <span class="hljs-number">5</span>];   
<span class="hljs-comment">// [2, 3, 4, 5]</span>
</code></pre>
<hr />
<p>Thanks for seeing this post if you found helpful let me know in the comments. </p>
]]></content:encoded></item><item><title><![CDATA[60+ Awesome UI and UX resources for Developers and Designers 2021]]></title><description><![CDATA[Yearning organizers, genuine solopreneurs, and sprouting visual creators all need a convincing proficient brand — or if nothing else the abilities and assets expected to foster one. 
Tragically, in case you're new to the visual communication world, t...]]></description><link>https://coderwatch.com/free-ui-resources</link><guid isPermaLink="true">https://coderwatch.com/free-ui-resources</guid><category><![CDATA[Web Development]]></category><category><![CDATA[General Programming]]></category><category><![CDATA[General Advice]]></category><category><![CDATA[UI]]></category><category><![CDATA[UX]]></category><dc:creator><![CDATA[Coder Watch]]></dc:creator><pubDate>Tue, 03 Aug 2021 04:50:58 GMT</pubDate><enclosure url="https://cdn.hashnode.com/res/hashnode/image/upload/v1627541199108/4TcPJ4S8r.png" length="0" type="image/jpeg"/><content:encoded><![CDATA[<p>Yearning organizers, genuine solopreneurs, and sprouting visual creators all need a convincing proficient brand — or if nothing else the abilities and assets expected to foster one. </p>
<p>Tragically, in case you're new to the visual communication world, this implies swimming through a confounding cluster of picture altering programming, stock picture locales, plan administrations, and considerably more. </p>
<p>To save you time, we've accumulated the best visual communication assets to help you construct a bespoke brand that separates you from your rivals. </p>
<p>Regardless of whether you're an originator searching for better visual communication apparatuses or an entrepreneur searching for practical programming, you'll track down the best paid and free visual UI and UX assets.</p>
<hr />
<h3 id="fancy-fontshttpsfancy-fontscom"><a target="_blank" href="https://fancy-fonts.com/">Fancy Fonts</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451328765/Bsb0sSN9f.png?auto=compress" alt /></p>
<p>Starting this list with one of my favourite resources of fonts. That is -&gt; Fancy Fonts. Find Beautiful Free Fonts—Script, Display, Calligraphy, Sans, Serif, Handwritten, Retro, and more—Download Now—Its FREE.</p>
<h3 id="stylish-fontshttpsstylishfontstop"><a target="_blank" href="https://stylishfonts.top/">Stylish Fonts</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1628229540983/EQEBFUjs0.png?auto=compress" alt /></p>
<p>Stylish Fonts Generator: 💕 Cool &amp; Fancy Text Fonts ✓ ⭐ Stylish name font for Instagram, Fb, Pubg &amp; Free fire. Stylish letters easily copy &amp; paste.</p>
<h3 id="motion-placeshttpsmotionplacescom"><a target="_blank" href="https://motionplaces.com">Motion Places</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451377249/x_PU5_3dM.png?auto=compress" alt /></p>
<p>Free Stock Video Footage by Motion Places. They offer a curated collection of beautiful footage you can use for your projects. Download our clips for free in HD quality, or purchase 4K clips for $99.</p>
<h3 id="fontjoyhttpsfontjoycom"><a target="_blank" href="https://fontjoy.com">Fontjoy</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451406457/kOqG39BLu.png?auto=compress" alt /></p>
<p>Fontjoy helps designers choose the best font combinations. Mix and match different fonts for the perfect pairing.</p>
<h3 id="cool-fontshttpscoolfontscool"><a target="_blank" href="https://coolfonts.cool/">Cool Fonts</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1628229498064/99OzAsZtb.png?auto=compress" alt /></p>
<p>Cool fonts generator—Copy and paste text fonts for your Instagram, WhatsApp, Twitter &amp; Facebook ⚡ ❤️ Cool letters, symbols, copy and paste easily.</p>
<h3 id="shotsnapphttpsshotsnappcom"><a target="_blank" href="https://shotsnapp.com">Shotsnapp</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451636111/cQGLNWMaS.png?auto=compress" alt /></p>
<p>Create beautiful device mockup image from the screenshots or design of your mobile app and websites. </p>
<h3 id="remixhttpsremixiconcom"><a target="_blank" href="https://remixicon.com">Remix</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451653393/nNtEQyMOV.png?auto=compress" alt /></p>
<p>Remix Icon is a set of open source neutral style system symbols elaborately crafted for designers and developers. All of the icons are free to use for both personal and commercial.</p>
<h3 id="font-changerhttpsfontchangertop"><a target="_blank" href="https://fontchanger.top/">Font changer</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1628229451213/o6UluFJds.png?auto=compress" alt /></p>
<p>Font changer— 😍💛 Cool &amp; stylish text fonts for your Instagram, Facebook &amp; Twitter. Easily copy and paste the fancy text.</p>
<h3 id="who-can-usehttpswhocanusecom"><a target="_blank" href="https://whocanuse.com">Who can use</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451679562/Nr40O437T.png?auto=compress" alt /></p>
<p>Find out who can use your color combination. </p>
<h3 id="colorsafehttpscolorsafeco"><a target="_blank" href="https://colorsafe.co">ColorSafe</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451730362/iIdq1X4id.png?auto=compress" alt /></p>
<p>Empowering designers with beautiful and accessible color palettes based on WCAG Guidelines of text and background contrast ratios.</p>
<h3 id="vexelshttpsvexelscom"><a target="_blank" href="https://vexels.com">Vexels</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451779458/glEW6Lxph.png?auto=compress" alt /></p>
<p>Graphic Resources for Commercial &amp; Merch Use ✓ Vector image illustrations, logos, design templates &amp; more ✓ T-Shirt Designs &amp; other Merch  ✓ PNG, AI, SVG, JPG, PDF</p>
<h3 id="open-doodleshttpswwwopendoodlescom"><a target="_blank" href="https://www.opendoodles.com/">Open Doodles</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451946734/rVR7pITib.png?auto=compress" alt /></p>
<p>A library of sketchy illustrations of people free for personal and commercial use.</p>
<h3 id="videvohttpsvidevonetstock-video-footage"><a target="_blank" href="https://videvo.net/stock-video-footage">Videvo</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451902562/Bswj7KhFD.png?auto=compress" alt /></p>
<p>Download free stock video footage with 4k and HD clips available. Click here to download royalty-free licensing videos from Videvo today.</p>
<h3 id="inkscapehttpsinkscapeorg"><a target="_blank" href="https://inkscape.org">Inkscape</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451965475/xuvRK5B3-.png?auto=compress" alt /></p>
<p>Inkscape is professional quality vector graphics software which runs on Linux, Mac OS X and Windows desktop computers.</p>
<h3 id="ioniconshttpsioniconscom"><a target="_blank" href="https://ionicons.com">Ionicons</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627451985394/V-F9Hl7ya.png?auto=compress" alt /></p>
<p>Ionicons is an open-sourced and MIT licensed icon pack.</p>
<h3 id="drawkithttpsdrawkitio"><a target="_blank" href="https://drawkit.io">DrawKit</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627452009870/wBUAbFxCQ.png?auto=compress" alt /></p>
<p>Free and premium vector SVG illustrations for you to use on your next project, no attribution required! Vector illustrations, packs, icons and more.</p>
<h3 id="dafontshttpswwwdafontcom"><a target="_blank" href="https://www.dafont.com/">DaFonts</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627452038293/pixE8Y97Gq.png?auto=compress" alt /></p>
<p>Archive of freely downloadable fonts. Browse by alphabetical listing, by style, by author or by popularity.</p>
<h3 id="the-noun-projecthttpsthenounprojectcom"><a target="_blank" href="https://thenounproject.com">The Noun Project</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627452078802/H3XiJ9xaV7.png?auto=compress" alt /></p>
<p>Noun Project features the most diverse collection of icons and stock photos ever. Download SVG and PNG. Browse over 3 million art-quality icons and photos.</p>
<h3 id="freepikhttpsfreepikcom"><a target="_blank" href="https://freepik.com">Freepik</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454940060/pPvuJ1GIWD.png?auto=compress" alt /></p>
<p>Millions of Free Graphic Resources. ✓ Vectors ✓ Stock Photos ✓ PSD ✓ Icons ✓ All that you need for your Creative Projects</p>
<h3 id="gravit-designerhttpsdesignerio"><a target="_blank" href="https://designer.io">Gravit Designer</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627452190848/3mn8nHscJ.png?auto=compress" alt /></p>
<p>Create graphics, design logos and icons, edit images illustrations &amp; presentations, all for free. Online professional vector graphic design tool - Gravit Designer</p>
<h3 id="bursthttpsburstshopifycom"><a target="_blank" href="https://burst.shopify.com">Burst</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627452627094/XMVsUUAGw.png?auto=compress" alt /></p>
<p>Browse thousands of beautiful copyright-free images. All our pictures are free to download for personal and commercial use, no attribution required.</p>
<h3 id="mrmockuphttpsmrmockupcomfreebies"><a target="_blank" href="https://mrmockup.com/freebies/">MrMockUp</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627452712840/pgfsDMqan.png?auto=compress" alt /></p>
<p>Free design freebies you need should check out</p>
<h3 id="material-iconshttpsmaterialioicons"><a target="_blank" href="https://material.io/icons">Material Icons</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627452772064/3mu8eHhui.png?auto=compress" alt /></p>
<p>Build beautiful, usable products faster. Material Design is an adaptable system—backed by open-source code—that helps teams build high quality digital experiences.</p>
<h3 id="scrnshtshttpsscrnshtsclub"><a target="_blank" href="https://scrnshts.club">Scrnshts</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627452874633/wZPiOAjKQ.png?auto=compress" alt /></p>
<p>A hand-picked collection of the finest app store design screenshots</p>
<h3 id="screenpeekhttpsscreenpeekio"><a target="_blank" href="https://screenpeek.io">Screenpeek</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453079525/Us7meIgdd.png?auto=compress" alt /></p>
<p>Screenpeek captures any website within a high quality mockup in seconds.</p>
<h3 id="isometrichttpsisometriconline"><a target="_blank" href="https://isometric.online">Isometric</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453103417/DP-ccmGtC.png?auto=compress" alt /></p>
<p>Free vector isometric illustrations for designers, startups and companies without the need to include attribution</p>
<h3 id="humaaanshttpshumaaanscom"><a target="_blank" href="https://humaaans.com">Humaaans</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453182648/NIkauY3MT.png?auto=compress" alt /></p>
<p>Mix-&amp;-match illustrations of people with a design library for InVIsion Studio and Sketch.</p>
<h3 id="shapehttpsshapeso"><a target="_blank" href="https://shape.so">Shape</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453157179/qQWHkrkPq.png?auto=compress" alt /></p>
<p>Shape lets you customize the style, colors and border of static &amp; animated icons and illustrations. You can export to React, SVG and Lottie code.</p>
<h3 id="landing-stockhttpslandingstockcom"><a target="_blank" href="https://landingstock.com">Landing Stock</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453195504/HNTY03PkS.png?auto=compress" alt /></p>
<p>Discover your perfect landing page in with LandingStock, a collection of free images for landing pages.</p>
<h3 id="happy-hueshttpshappyhuesco"><a target="_blank" href="https://happyhues.co">Happy Hues</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453220019/W_LY80wqA.png?auto=compress" alt /></p>
<p>See color palette inspiration on a real example website. As you click on different palettes every color on this site updates to give you context of how that color could be used for your design or illustration projects.</p>
<h3 id="flaticonhttpsflaticoncom"><a target="_blank" href="https://flaticon.com">Flaticon</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453238093/C7ASTLtkC.png?auto=compress" alt /></p>
<p>Download Free Vector Icons and Stickers for your projects. Resources made by and for designers. PNG, SVG, EPS, PSD and CSS formats</p>
<h3 id="joe-schmoehttpsjoeschmoeio"><a target="_blank" href="https://joeschmoe.io">Joe Schmoe</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453294400/NVuTCL8by.png?auto=compress" alt /></p>
<p>An illustrated avatar generator for developers and designers.</p>
<h3 id="lukasz-adam-free-illustrationshttpslukaszadamcom"><a target="_blank" href="https://lukaszadam.com">Lukasz Adam Free Illustrations</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453314390/rmH9jPmU4.png?auto=compress" alt /></p>
<p>Hey! Looking for the free Illustration guys? That's me. Check out my illustrations and my other resources.</p>
<h3 id="principlehttpsprincipleformaccom"><a target="_blank" href="https://principleformac.com">Principle</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453402497/RdhzJpQ2n.png?auto=compress" alt /></p>
<p>Principle makes it easy to design animated and interactive user interfaces. Whether you're designing the flow of a multi-screen app, or new interactions and animations, Principle helps you create designs that look and feel amazing.</p>
<h3 id="mockup-worldhttpsmockupworldco"><a target="_blank" href="https://mockupworld.co">Mockup World</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453423748/rhAbMynM9.png?auto=compress" alt /></p>
<p>Tons of free and legal, fully layered, easily customizable photo realistic PSD mockups: Ready to use in your projects, app showcases and presentations!</p>
<h3 id="httpsterhttpshttpsternet"><a target="_blank" href="https://httpster.net">Httpster</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453550047/4m3CGL9V9.png?auto=compress" alt /></p>
<p>Tons of free and legal, fully layered, easily customizable photo realistic PSD mockups: Ready to use in your projects, app showcases and presentations!</p>
<h3 id="animaticonshttpsanimaticonsco"><a target="_blank" href="https://animaticons.co">Animaticons</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453528086/gwN2gyMN3.png?auto=compress" alt /></p>
<p>Animaticons are a growing set of beautiful, high-resolution, animated GIF icons that you can customize. They are perfect for websites, emails, presentations and more</p>
<h3 id="social-sizeshttpssocialsizesio"><a target="_blank" href="https://socialsizes.io">Social Sizes</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453491952/GyG6Zt-ER.png?auto=compress" alt /></p>
<p>SocialSizes provides designers with the best sizes to use for Image and Video content on Social Media. Get downloadable templates for Sketch, Figma, Photoshop and Adobe XD (no more googling for everything).</p>
<h3 id="screeenlanehttpsscreenlanecom"><a target="_blank" href="https://screenlane.com">ScreeenLane</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453574613/a2V-WSBTj.png?auto=compress" alt /></p>
<p>Get inspired and keep up with the latest web &amp; mobile app UI design trends. </p>
<h3 id="checklisthttpschecklistdesign"><a target="_blank" href="https://checklist.design">Checklist</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453680956/DDhLiVbLN.png?auto=compress" alt /></p>
<p>Checklist Design is a curated list of checklists ranging from website pages, to UI components, all the way to branding assets.</p>
<h3 id="fonts-squirrelhttpsfontsquirrelcom"><a target="_blank" href="https://fontsquirrel.com">Fonts Squirrel</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453709053/m1Ke2qQ2L.png?auto=compress" alt /></p>
<p>Font Squirrel scours the internet for high quality, legitimately free fonts . Download thousands of completely legal, high quality, free fonts.</p>
<h3 id="typewolfhttpstypewolfcom"><a target="_blank" href="https://typewolf.com">Typewolf</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453740814/HOMwMd4wv.png?auto=compress" alt /></p>
<p>Typewolf helps designers choose the perfect font combination for their next design project—features web fonts in the wild, font recommendations and learning resources.</p>
<h3 id="humanehttpshumanebydesigncom"><a target="_blank" href="https://humanebydesign.com">Humane</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453804321/q0eignVmP.png?auto=compress" alt /></p>
<p>A resource that provides guidance for designing ethically humane digital products through patterns focused on user well-being.</p>
<h3 id="mixkithttpsmixkitco"><a target="_blank" href="https://mixkit.co">Mixkit</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453780870/1x-T4WXJN.png?auto=compress" alt /></p>
<p>Download Free Stock Video Footage, Stock Music &amp; Premiere Pro Templates for your next video editing project. All assets can be downloaded for free!</p>
<h3 id="rawpixelhttpsrawpixelscom"><a target="_blank" href="https://rawpixels.com">Rawpixel</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627455811070/LnbSgz8Ml.png?auto=compress" alt /></p>
<p>Rawpixels is a portfolio of design work by Bill Safsel.</p>
<h3 id="lost-typehttpslosttypecom"><a target="_blank" href="https://losttype.com">Lost Type</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453959026/9ykX8pbXP.png?auto=compress" alt /></p>
<p>Lost Type is a Collaborative Digital Type Foundry.</p>
<h3 id="craftworkhttpscraftworkdesign"><a target="_blank" href="https://craftwork.design">Craftwork</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627453995077/ljz6i8dxt.png?auto=compress" alt /></p>
<p>Interface assets for designers, developers, and startup creatives. Speed up your design workflow with high-quality UX/UI kits, illustrations, and templates.</p>
<h3 id="feather-iconshttpsfeathericonscom"><a target="_blank" href="https://feathericons.com">Feather Icons</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454012171/qN49qsl99.png?auto=compress" alt /></p>
<p>Feather is a collection of simply beautiful open source icons. Each icon is designed on a 24x24 grid with an emphasis on simplicity, consistency and readability.</p>
<h3 id="color-claimhttpsvanschneidercomcolors"><a target="_blank" href="https://vanschneider.com/colors">Color Claim</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454125586/bAF6jxmkc.png?auto=compress" alt /></p>
<p>ColorClaim is simple. Everything and amazing favorite color combinations on one big page</p>
<h3 id="coverrhttpscoverrco"><a target="_blank" href="https://coverr.co">Coverr</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454159279/Gaa1v0Quv.png?auto=compress" alt /></p>
<p>Download royalty free (for personal and commercial use), unique and beautiful video footage for your website or any project. No attribution required.</p>
<h3 id="pixedenhttpspixedencom"><a target="_blank" href="https://pixeden.com">Pixeden</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454205830/N1OAZ_Bab.png?auto=compress" alt /></p>
<p>Pixeden is hard at work providing quality premium and free web resources and graphic design templates. Enjoy!</p>
<h3 id="sketchsheetshttpssketchsheetscom"><a target="_blank" href="https://sketchsheets.com">Sketchsheets</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454228547/N4EP1CyCF.png?auto=compress" alt /></p>
<p>Sketchsheets is an open source project dedicated to providing free printable templates of the latest devices and platforms for wireframing designs.</p>
<h3 id="right-fonthttpsrightfontappcom"><a target="_blank" href="https://rightfontapp.com">Right Font</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454298954/fWXVMyCrc.png?auto=compress" alt /></p>
<p>Professional and beautiful font manager and font organizer app, helps preview, sync, install and organize fonts over iCloud, Dropbox. All-in-one Font Manager for business.</p>
<h3 id="colorssparkhttpscolorsparkapp"><a target="_blank" href="https://colorspark.app">ColorsSpark</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454324105/3lw5kmMO-.png?auto=compress" alt /></p>
<p>Professional and beautiful font manager and font organizer app, helps preview, sync, install and organize fonts over iCloud, Dropbox. All-in-one Font Manager for business.</p>
<h3 id="flowkithttpsuseflowkitcom"><a target="_blank" href="https://useflowkit.com">Flowkit</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454439881/x847v5i1t.png?auto=compress" alt /></p>
<p>User flows right inside your favorite design tool. </p>
<h3 id="landbookhttpsland-bookcom"><a target="_blank" href="https://land-book.com">Landbook</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454468760/IA0wYeQlU.png?auto=compress" alt /></p>
<p>Design gallery with the best and most carefully collected websites. We help creatives find inspiration &amp; motivation to do rad stuff.</p>
<h3 id="colorsinspohttpscolorsinspocom"><a target="_blank" href="https://colorsinspo.com">Colorsinspo</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454634203/MXqKanBTHu.png?auto=compress" alt /></p>
<p>Colorsinspo is all in one resource to find everything about colors with extreme ease. Also, you will get Freebies, Inspirations, Color Tools, Gradients and thousands of trendy hand-picked color palettes.</p>
<h3 id="mazehttpsmazedesign"><a target="_blank" href="https://maze.design">Maze</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454607504/SZvukG4y7.png?auto=compress" alt /></p>
<p>Get user feedback with Maze's remote testing platform. Power your product and marketing team with quantifiable insights you can act on, instantly.</p>
<h3 id="saaspageshttpssaaspagesxyz"><a target="_blank" href="https://saaspages.xyz/">SaaSPages</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627454763690/MWOO97osl.png?auto=compress" alt /></p>
<p>A collection of the best landing pages with a focus on copywriting and design.</p>
<h3 id="foodies-foodhttpswwwfoodiesfeedcom"><a target="_blank" href="https://www.foodiesfeed.com/">Foodies Food</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627456305630/URCS8I2ZH.png?auto=compress" alt /></p>
<p>Find food images uploaded by Food Bloggers. </p>
<h3 id="removalaihttpsremovalai"><a target="_blank" href="https://removal.ai">RemovalAI</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627455161262/0NgDe7Yzi.png?auto=compress" alt /></p>
<p>Remove Image Background Free Using Artificial Intelligence </p>
<h3 id="snapshotshttpsnappy-appcom"><a target="_blank" href="http://snappy-app.com/">Snapshots</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627455266385/KLq8lFJTQ.png?auto=compress" alt /></p>
<p>Snapshots, the smart way.</p>
<p>Your day-to-day App to instantly work and collaborate on snapshots. </p>
<h3 id="streamline-emojishttpsappstreamlinehqcomemojisfreebies-freemojis"><a target="_blank" href="https://app.streamlinehq.com/emojis/freebies-freemojis">Streamline Emojis</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627455002333/3pch8vltm.png?auto=compress" alt /></p>
<p>A cute vector emoji set that you can use for free in your applications, websites or publications. Use the vectors for free but you must credit us with a link.</p>
<h3 id="morguefilehttpsmorguefilecom"><a target="_blank" href="https://morguefile.com">MorgueFile</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627455486690/1CHSK6gFJ3.png?auto=compress" alt /></p>
<p>Free images for creatives, by creatives. A post production file, over 400,000 free stock photos for commercial use.</p>
<h3 id="new-old-stockhttpsnostwnsndco"><a target="_blank" href="https://nos.twnsnd.co/">New Old Stock</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627455049642/pRUO0F_MP.png?auto=compress" alt /></p>
<p>Vintage photos from the public archives.
Free of known copyright restrictions.
Recapturing History.</p>
<hr />
<p>Best of luck utilizing these free assets on your future visual communication projects!</p>
<p>Mainly we would give the credits to the people making these resources and we're very proud promiting them all on our channels. If you are looking to add your amazing resource into this list just comment down below, we'll help you.</p>
]]></content:encoded></item><item><title><![CDATA[13 Cool looking programming Fonts in 2021]]></title><description><![CDATA[We go through the whole day utilizing code editors, terminal emulators, and other designer apparatuses. Utilizing a textual style that feels great to your eyes can have an enormous effect and work on your usefulness. 
Here's a gathering of the best f...]]></description><link>https://coderwatch.com/cool-fonts</link><guid isPermaLink="true">https://coderwatch.com/cool-fonts</guid><category><![CDATA[Web Development]]></category><category><![CDATA[General Advice]]></category><category><![CDATA[JavaScript]]></category><category><![CDATA[Design]]></category><dc:creator><![CDATA[Coder Watch]]></dc:creator><pubDate>Mon, 02 Aug 2021 05:50:22 GMT</pubDate><enclosure url="https://cdn.hashnode.com/res/hashnode/image/upload/v1627653313096/awXPQYbfc.png" length="0" type="image/jpeg"/><content:encoded><![CDATA[<p>We go through the whole day utilizing code editors, terminal emulators, and other designer apparatuses. Utilizing a textual style that feels great to your eyes can have an enormous effect and work on your usefulness. </p>
<p>Here's a gathering of the best free monospace textual styles for coding, alongside extra remarks and download joins. </p>
<hr />
<h3 id="monoidhttpsgithubcomlarsenworkmonoid"><a target="_blank" href="https://github.com/larsenwork/monoid">Monoid</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627624909599/htVD3J6Zc.png?auto=compress" alt /></p>
<p>Customisable coding font with alternates, ligatures and contextual positioning</p>
<h3 id="droid-sans-monohttpsdamiengcomblog20071114droid-sans-mono-great-coding-font"><a target="_blank" href="https://damieng.com/blog/2007/11/14/droid-sans-mono-great-coding-font">Droid Sans MONO</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627624943350/UXqm2xexh.png?auto=compress" alt /></p>
<h3 id="press-start-2phttpsfontmemecomfontspress-start-2p-font"><a target="_blank" href="https://fontmeme.com/fonts/press-start-2p-font/">Press Start 2P</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627625004645/sNKzUykMI.png?auto=compress" alt /></p>
<h3 id="source-code-prohttpsgithubcomadobe-fontssource-code-pro"><a target="_blank" href="https://github.com/adobe-fonts/source-code-pro">Source Code Pro</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627625073300/xSLv78a0vK.png?auto=compress" alt /></p>
<p>Monospaced font family for user interface and coding environments </p>
<h3 id="jetbrains-monohttpswwwjetbrainscomlpmono"><a target="_blank" href="https://www.jetbrains.com/lp/mono/">JetBrains Mono</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627625112141/2PWC0-5Gc.png?auto=compress" alt /></p>
<p>An amazing free and open source typeface for developers. </p>
<h3 id="hackhttpsgithubcomsource-foundryhack"><a target="_blank" href="https://github.com/source-foundry/Hack">Hack</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627625236358/igvFghzlY.png?auto=compress" alt /></p>
<p>A typeface designed for source code </p>
<h3 id="monalisahttpswwwmonolisadev"><a target="_blank" href="https://www.monolisa.dev/">MonaLisa</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627625256034/dkPWn848v.png?auto=compress" alt /></p>
<p>A font family designed for software developers. Font follows function.</p>
<h3 id="dank-monohttpsdanksh"><a target="_blank" href="https://dank.sh/">Dank Mono</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627625522176/PWbeYu8Qb.png?auto=compress" alt /></p>
<p>A typeface designed for coding aesthetes with modern displays in mind. Delightful ligatures and an italic variant and bold style. It's paid but worth it. </p>
<h3 id="input-monohttpsinputdjrcom"><a target="_blank" href="https://input.djr.com/">Input Mono</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627625559763/hX0l8Acs6.png?auto=compress" alt /></p>
<p>Fonts for code from DJR &amp; Font Bureau. </p>
<h3 id="firacodehttpsgithubcomtonskyfiracode"><a target="_blank" href="https://github.com/tonsky/FiraCode">Firacode</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627625692828/Vumtj_9xu.png?auto=compress" alt /></p>
<p>Free monospaced font with programming ligatures </p>
<h3 id="anonymous-prohttpswwwmarksimonsoncomfontsviewithanonymous-pro"><a target="_blank" href="https://www.marksimonson.com/fonts/view/anonymous-pro">Anonymous Pro</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627625727117/v_cvTTsbA.png?auto=compress" alt /></p>
<p>Comes with 4 style and fixed width designs. Mark Simmonson offer many fonts too. </p>
<h3 id="hasklighttpsgithubcomi-tuhasklig"><a target="_blank" href="https://github.com/i-tu/Hasklig">Hasklig</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627625985277/Q41AIqzhe.png?auto=compress" alt /></p>
<p>Hasklig - a code font with monospaced ligatures </p>
<h3 id="iosevkahttpsgithubcombe5invisiosevka"><a target="_blank" href="https://github.com/be5invis/Iosevka">Iosevka</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627626007540/9Vt46FAK0.png?auto=compress" alt /></p>
<p>Versatile typeface for code, from code. </p>
<hr />
<p>Textual styles, actually like topics, are an exceptionally close to home subject. Various engineers like various textual styles. Some adoration ligatures, others disdain. Some adoration italics, others disdain. </p>
<p>Ideally, this aggregation was valuable to recognize what turns out best for you. Try it out, attempt them a few days, and you'll see the distinction. </p>
<p>I'd love to hear which one you like the most.</p>
]]></content:encoded></item><item><title><![CDATA[21 Amazing VS Code extensions for maximum productivity 2021]]></title><description><![CDATA[Visual Studio Code is a source code editor for building current web applications. It is a free and open-source manager. It upholds various augmentations that can be utilized for web application advancement. In this blog, we will discuss 21 of these e...]]></description><link>https://coderwatch.com/vs-max-productivity</link><guid isPermaLink="true">https://coderwatch.com/vs-max-productivity</guid><category><![CDATA[Web Development]]></category><category><![CDATA[General Advice]]></category><category><![CDATA[Productivity]]></category><category><![CDATA[JavaScript]]></category><dc:creator><![CDATA[Coder Watch]]></dc:creator><pubDate>Fri, 30 Jul 2021 05:52:46 GMT</pubDate><enclosure url="https://cdn.hashnode.com/res/hashnode/image/upload/v1627541465794/IjldDRvkx.png" length="0" type="image/jpeg"/><content:encoded><![CDATA[<p>Visual Studio Code is a source code editor for building current web applications. It is a free and open-source manager. It upholds various augmentations that can be utilized for web application advancement. In this blog, we will discuss 21 of these extensions that are utilized in fostering a web application. </p>
<hr />
<h3 id="markdown-all-in-onehttpsmarketplacevisualstudiocomitemsitemnameyzhangmarkdown-all-in-one"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=yzhang.markdown-all-in-one">Markdown All in One</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626969791427/6WcVCprBM.png?auto=compress" alt=" " /></p>
<p>All you need for Markdown (keyboard shortcuts, table of contents, auto preview and more). One of my fav VS Code extensions as I write in makrdown format inside VS Code. </p>
<h3 id="code-spell-checkerhttpsmarketplacevisualstudiocomitemsitemnamestreetsidesoftwarecode-spell-checker"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=streetsidesoftware.code-spell-checker">Code Spell Checker</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626969893440/GZ8lABiIM.png?auto=compress" alt=" " /></p>
<p>A basic spell checker that works well with camelCase code.</p>
<p>The goal of this spell checker is to help catch common spelling errors while keeping the number of false positives low.</p>
<h3 id="debugger-for-chromehttpsmarketplacevisualstudiocomitemsitemnamemsjsdiagdebugger-for-chrome"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=msjsdiag.debugger-for-chrome">Debugger for Chrome</a></h3>
<p><img src="https://github.com/Microsoft/vscode-chrome-debug/blob/master/images/demo.gif?raw=true" alt=" " /></p>
<p>Debug your JavaScript code in the Chrome browser, or any other target that supports the Chrome Debugger protocol.</p>
<h3 id="toggle-quoteshttpsmarketplacevisualstudiocomitemsitemnamebritesnowvscode-toggle-quotes"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=BriteSnow.vscode-toggle-quotes">Toggle Quotes</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280170449/hX82s8Kar.png?auto=compress" alt=" " /></p>
<p>Simple quote toggler that cycle through <code>" ' and</code> `. </p>
<h3 id="bookmarkshttpsmarketplacevisualstudiocomitemsitemnamealefragnanibookmarks"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=alefragnani.Bookmarks">Bookmarks</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280204046/vhb2g3Tyx.png?auto=compress" alt=" " /></p>
<p>Essentially this extension permits you to add bookmarks in explicit lines in a record. You can likewise add a note why you have added this bookmark. Furthermore, you can likewise investigate the bookmarks in the bookmarks tab. Which will show you every one of the bookmarks in a specific venture.</p>
<h3 id="better-commentshttpsmarketplacevisualstudiocomitemsitemnameaaron-bondbetter-comments"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=aaron-bond.better-comments">Better Comments</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280220807/NSvGfZC_9.png?auto=compress" alt=" " /></p>
<p>The Better Comments extension will assist you with making human-accommodating remarks in your code.
With this extension, you will be able to categorise your annotations into:</p>
<ul>
<li>Alerts</li>
<li>Queries</li>
<li>TODOs</li>
<li>Highlights</li>
</ul>
<h3 id="clipboard-historyhttpsmarketplacevisualstudiocomitemsitemnameanjaliclipboard-history"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=Anjali.clipboard-history">Clipboard History</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280244577/5W36nHUfS.png?auto=compress" alt=" " /></p>
<p>Keep a history of your copied items and re-paste if needed.</p>
<h3 id="thunder-clienthttpsmarketplacevisualstudiocomitemsitemnamerangavvscode-thunder-client"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=rangav.vscode-thunder-client">Thunder Client</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280259237/LbhHuj2g_u.png?auto=compress" alt=" " /></p>
<p>Rest API Client for VS Code, GUI based Http Client.</p>
<h3 id="gitlenshttpsmarketplacevisualstudiocomitemsitemnameeamodiogitlens"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=eamodio.gitlens">Gitlens</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280287010/EEW9b1g3G.png?auto=compress" alt=" " /></p>
<p>Supercharge the Git capabilities built into Visual Studio Code — Visualize code authorship at a glance via Git blame annotations and code lens, seamlessly navigate and explore Git repositories, gain valuable insights via powerful comparison commands, and so much more</p>
<h3 id="error-lenshttpsmarketplacevisualstudiocomitemsitemnameusernamehwerrorlens"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=usernamehw.errorlens">Error Lens</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280314977/V7TsyeJzD.png?auto=compress" alt=" " /></p>
<p>ErrorLens super charges language demonstrative highlights by making diagnostics stand apart more noticeably, featuring the whole line any place an indicative is produced by the language and furthermore prints the message inline.</p>
<h3 id="setting-synchttpsmarketplacevisualstudiocomitemsitemnameshancode-settings-sync"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=Shan.code-settings-sync">Setting Sync</a></h3>
<p>![ ]( https://cdn.hashnode.com/res/hashnode/image/upload/v1627280345474/HpAx2zEem.png?auto=compress</p>
<p>Synchronize Settings, Snippets, Themes, File Icons, Launch, Keybindings, Workspaces and Extensions Across Multiple Machines Using GitHub Gist.</p>
<h3 id="import-costhttpsmarketplacevisualstudiocomitemsitemnamewixvscode-import-cost"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=wix.vscode-import-cost">Import Cost</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280360511/GiT8IdxT8.png?auto=compress" alt=" " /></p>
<p>This extension will show inline in the supervisor the size of the imported bundle. The extension uses webpack with 'babel-webpack-module' to identify the imported size.</p>
<h3 id="css-peekhttpsmarketplacevisualstudiocomitemsitemnamepranaygpvscode-css-peek"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=pranaygp.vscode-css-peek">CSS Peek</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280509836/jmNLuIM3f.png?auto=compress" alt=" " /></p>
<p>Allow peeking to css ID and class strings as definitions from html files to respective CSS. Allows peek and goto definition.</p>
<h3 id="turbo-console-loghttpsmarketplacevisualstudiocomitemsitemnamechakrounanasturbo-console-log"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=ChakrounAnas.turbo-console-log">Turbo Console Log</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280528402/i6yPmRmAQ.png?auto=compress" alt=" " /></p>
<p>Automating the process of writing meaningful log messages.</p>
<h3 id="open-in-browserhttpsmarketplacevisualstudiocomitemsitemnametecheropen-in-browser"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=techer.open-in-browser">Open in Browser</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280548540/6rjxpX7as.png?auto=compress" alt=" " /></p>
<p>This allows you to open the current file in your default browser or application.</p>
<h3 id="auto-rename-taghttpsmarketplacevisualstudiocomitemsitemnameformulahendryauto-rename-tag"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=formulahendry.auto-rename-tag">Auto Rename Tag</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626967104800/QMkulcz3s.png?auto=compress" alt=" " /></p>
<p>Automatically rename paired HTML/XML tag, same as Visual Studio IDE does.</p>
<h3 id="to-do-highlighthttpsmarketplacevisualstudiocomitemsitemnamewayouvscode-todo-highlight"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=wayou.vscode-todo-highlight">TO-DO highlight</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280573856/DOmfgHJad.png?auto=compress" alt=" " /></p>
<p>Highlight <code>TODO</code>, <code>FIXME</code> and other annotations within your code.</p>
<h3 id="polacodehttpsmarketplacevisualstudiocomitemsitemnamepnppolacode"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=pnp.polacode">Polacode</a></h3>
<p><img src="https://github.com/octref/polacode/raw/master/demo/usage.gif" alt=" " /></p>
<p>This extension is utilized for taking code bit screen captures. It tends to be utilized to reorder the code you need in piece screen captures effectively and save them in the wake of introducing the extension. You can track down the itemized data with respect to the extension in the accompanying connection.</p>
<h3 id="git-historyhttpsmarketplacevisualstudiocomitemsitemnamedonjayamannegithistory"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=donjayamanne.githistory">Git History</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280619702/X_l2XGhEX.png?auto=compress" alt=" " /></p>
<p>View git log, file history, compare branches or commits. </p>
<h3 id="prettierhttpsmarketplacevisualstudiocomitemsitemnameesbenpprettier-vscode"><a target="_blank" href="https://marketplace.visualstudio.com/items?itemName=esbenp.prettier-vscode">Prettier</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280647762/gcJHpbo10.png?auto=compress" alt=" " /></p>
<p>Prettier is an obstinate code formatter. It implements a predictable style by parsing your code and re-printing it with its own guidelines that consider the greatest line length, wrapping code when essential.</p>
<h3 id="profile-switcherhttpsmarketplacevisualstudiocomitemsitemnameaaronpowellvscode-profile-switcher">Profile Switcher](https://marketplace.visualstudio.com/items?itemName=aaronpowell.vscode-profile-switcher)</h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1627280677207/isPjYdLFs.png?auto=compress" alt=" " /></p>
<p>Allows you to switch between different profiles you have created. This Extension permits you to characterize various settings profiles that you can without much of a stretch switch between. </p>
<p>The first thought for this extension came from my longing to have a simple way for me to switch my VS Code to an arrangement that was better streamlined for introducing. </p>
<hr />
<p>These were 21 VSCode extension to further develop your programming efficiency without impinging on quality. In the event that you partook in this article and figure others can profit with it too, go ahead and share it via online media utilizing the catches at the highest point of the page.</p>
]]></content:encoded></item><item><title><![CDATA[13 Super Amazing resume tips for Developers to get a JOB in 2021]]></title><description><![CDATA[Nothing is more awful than going through weeks or months going after a programming position and always failing to get a get back to. The opposition out there can be overwhelming, and the traditional counsel is to ensure that your resume sticks out. B...]]></description><link>https://coderwatch.com/resume-tips</link><guid isPermaLink="true">https://coderwatch.com/resume-tips</guid><category><![CDATA[General Programming]]></category><category><![CDATA[General Advice]]></category><category><![CDATA[Web Development]]></category><category><![CDATA[JavaScript]]></category><category><![CDATA[Developer]]></category><dc:creator><![CDATA[Coder Watch]]></dc:creator><pubDate>Wed, 28 Jul 2021 05:09:53 GMT</pubDate><enclosure url="https://cdn.hashnode.com/res/hashnode/image/upload/v1627105278920/h6FBUsV1o.png" length="0" type="image/jpeg"/><content:encoded><![CDATA[<p>Nothing is more awful than going through weeks or months going after a programming position and always failing to get a get back to. The opposition out there can be overwhelming, and the traditional counsel is to ensure that your resume sticks out. Be that as it may, how?</p>
<p>Obviously, there's nothing of the sort as an ideal resume. What works at one organization may not dazzle the employing director at another. Each CTO or designing supervisor I know has an alternate arrangement of abilities or rundown of warnings, so shockingly no rundown of tips will promise you a task. </p>
<p>In any case, there are a few recommendations that are all around accommodating in creating an extraordinary programming improvement continue.</p>
<hr />
<h3 id="look-for-typos">Look for typos</h3>
<p><img src="https://images.unsplash.com/photo-1616990277483-c801063f6946?ixid=MnwxMjA3fDB8MHxwaG90by1wYWdlfHx8fGVufDB8fHx8&amp;ixlib=rb-1.2.1&amp;auto=format&amp;fit=crop&amp;w=637&amp;q=80" alt /></p>
<p>Try not to blow a gasket about each and every word decision, yet keep your sentence structure reliable and for hell's sake, spell things effectively. Each PC on the planet has spellcheck. Show that you care enough to address the squiggly red lines on your resume. </p>
<p>Keep in mind: Developers need solid tender loving care, and you need to show that you have that. So regardless of whether "expressing" isn't your solid suit, this is a simple chance to show that you can get even the littlest of mistakes.</p>
<h3 id="include-sub-headings">Include sub-headings</h3>
<p><img src="https://images.unsplash.com/photo-1504691342899-4d92b50853e1?ixid=MnwxMjA3fDB8MHxwaG90by1wYWdlfHx8fGVufDB8fHx8&amp;ixlib=rb-1.2.1&amp;auto=format&amp;fit=crop&amp;w=750&amp;q=80" alt /></p>
<p>Regardless of whether you're utilizing a resume format or making your own, you may discover there are some suggested segments you needn't bother with. </p>
<p>For instance, you may require a resume rundown or a resume objective, however you ought exclude both. In case you are simply moving on from school or secondary school and have not yet stood firm on an expert situation, do exclude an unfilled work history segment. All things considered, you could supplant the experience segment with applicable coursework, scholarly accomplishments and different encounters like entry level positions or extracurricular undertakings.</p>
<h3 id="email-matters-too">Email matters too</h3>
<p><img src="https://images.unsplash.com/photo-1557200134-90327ee9fafa?ixid=MnwxMjA3fDB8MHxwaG90by1wYWdlfHx8fGVufDB8fHx8&amp;ixlib=rb-1.2.1&amp;auto=format&amp;fit=crop&amp;w=750&amp;q=80" alt /></p>
<p>To set up a meeting, most employing chiefs will send you an email. However, in case you're utilizing an odd handle (or one that is equivalent to your filthy Twitter account), it just could alter their perspectives. I propose a blend of your first and last names or initials. </p>
<p>Keep in mind, designers should be educated. In case you're utilizing a Hotmail account, I won't be intrigued with your web ability. </p>
<p>It's actual: These tips probably won't make composing your resume any simpler. However, they will help you realize that you're destined for success when you're presenting an application, and that is definitely justified.</p>
<h3 id="projects-and-side-hustle-matters">Projects and Side hustle matters</h3>
<p><img src="https://images.unsplash.com/photo-1572177812156-58036aae439c?ixid=MnwxMjA3fDB8MHxwaG90by1wYWdlfHx8fGVufDB8fHx8&amp;ixlib=rb-1.2.1&amp;auto=format&amp;fit=crop&amp;w=750&amp;q=80" alt /></p>
<p>Your resume ought to be separated into four principle areas: experience, schooling, abilities, and undertakings. That last part is particularly significant for a computer programmer continue. </p>
<p>Regardless of whether you're simply beginning and you don't have long stretches of work insight behind you, you can in any case flaunt your abilities by posting the ventures you've finished. Work projects, individual ventures, coding bootcamp projects; list whatever's pertinent to the work you're searching for. </p>
<p>"Businesses love to perceive what you've been really going after voluntarily," Demirev says. "Side undertakings show that you go the extra mile. You're not just learning at school or at work for your own advantage, you're additionally assembling something you appreciate." </p>
<p>Another professional tip: incorporate metrics. In the event that you helped fabricate a site that increased from a couple dozen guests every day to hundreds, then, at that point you need to incorporate that data. Anything that shows substantial outcomes works for your potential benefit.</p>
<h3 id="make-your-contact-info-notable">Make Your Contact Info Notable</h3>
<p><img src="https://images.unsplash.com/photo-1499159058454-75067059248a?ixid=MnwxMjA3fDB8MHxwaG90by1wYWdlfHx8fGVufDB8fHx8&amp;ixlib=rb-1.2.1&amp;auto=format&amp;fit=crop&amp;w=751&amp;q=80" alt /></p>
<p>You don't have to remember your location for your resume any longer (truly!), however you do have to try to incorporate a telephone number and expert email address (not your business locale!) just as different spots the employing director can discover you on the web, similar to your LinkedIn profile and Twitter handle. </p>
<h3 id="ats-friendly">ATS friendly?</h3>
<p>At the point when you go after a position, your resume frequently goes through an Applicant Tracking System(ATS) before it at any point arrives at an individual. The ATS examines your resume and introductory letter, then, at that point scores your application dependent on how well the catchphrases contrast with the set of working responsibilities. </p>
<p>Numerous enormous organizations, particularly Fortune 500 organizations, spend critical cash on global positioning frameworks to look over the tidal wave of approaching applications. </p>
<p>Out of that load of candidates, the employing chief may just glance at the main 10 or 20 continues that scored the most elevated by the ATS. Assuming you need your resume to be seen, ensure it's in a standard organization and matches the expected set of responsibilities as intently as could really be expected. </p>
<p>Likewise, do exclude any non-text components that could entangle the framework. These frameworks are simply keen enough to parse through text resumes, so on the off chance that you use pictures, tables, or a strange organization, the ATS may consign you to the lower part of the heap.</p>
<h3 id="make-it-one-stride-further">Make it One Stride Further</h3>
<p><img src="https://images.unsplash.com/photo-1531167599833-609a45d3d903?ixid=MnwxMjA3fDB8MHxwaG90by1wYWdlfHx8fGVufDB8fHx8&amp;ixlib=rb-1.2.1&amp;auto=format&amp;fit=crop&amp;w=750&amp;q=80" alt /></p>
<p>Individuals employ performers, so you need to show that you didn't simply stuff, however that you completed stuff! As you take a gander at your list items, consider how you can make every assertion one stride further and include what the advantage was to your chief or your organization. </p>
<p>By doing this, you obviously convey what you're able to do, yet additionally the immediate advantage the business will get by recruiting you.</p>
<h3 id="make-scanning-easy">Make scanning easy</h3>
<p><img src="https://images.unsplash.com/photo-1617651482504-4b0d8bf23ba0?ixid=MnwxMjA3fDB8MHxwaG90by1wYWdlfHx8fGVufDB8fHx8&amp;ixlib=rb-1.2.1&amp;auto=format&amp;fit=crop&amp;w=751&amp;q=80" alt /></p>
<p>Use list items whenever the situation allows. The easiest thing I can propose to you is to stay with list items whenever the situation allows, and keeping those sentences truly short (close to 2 lines of text). </p>
<p>Utilize dynamic voice and basic language structure. Be immediate and succinct. Talk about the effect. Make it direct to sort out what you really did (or are doing) at your most recent work. </p>
<p>Brain the most extreme width for meaningfulness. List items will not help if the width of your sections or records are excessively wide. 70-75 characters is the greatest. </p>
<p>Utilize striking content to counterbalance significant data. Perceive how I'm doing that in this blog entry? You can do that on your CV. One way I've actually done this is to incorporate the advancements I effectively utilized underneath the list item outline of my obligations in a specific position.</p>
<h3 id="divide-them-evenly">Divide Them Evenly</h3>
<p><img src="https://images.unsplash.com/photo-1422207049116-cfaf69531072?ixlib=rb-1.2.1&amp;ixid=MnwxMjA3fDB8MHxwaG90by1wYWdlfHx8fGVufDB8fHx8&amp;auto=format&amp;fit=crop&amp;w=1920&amp;q=80" alt /></p>
<p>In the event that you have heaps of abilities identified with a position—say, unknown dialect, programming, and initiative abilities—give breaking a shot one of those segments and posting it all alone. Beneath your "Abilities" segment, add another part named "Language Skills" or "Programming Skills," and detail your experience there. Once more—we're going for skimmability here, people!</p>
<h3 id="dont-decorate">Don't decorate</h3>
<p>Altered means you talk about the abilities you have and how they identify with a particular job. It doesn't mean exaggerate so you resemble a fantasy candidate. You'd be amazed the number of designers send me resumes professing to be "profoundly knowledgeable about ability X," yet when it comes time to talk with, I'm disclosed to it's something they just started learning. </p>
<p>I accept this as a sign that a candidate is lying—or totally uninformed of his experience level. (In any case, it essentially closes the meeting.) So, be straightforward, even about the seemingly insignificant details.</p>
<h3 id="incorporate-just-the-most-applicable-data-and-put-the-main-data-first">Incorporate just the most applicable data and put the main data first</h3>
<p>While you may have broad work or instructive experience, keep your resume as brief as conceivable without leaving out key data. Recruiting administrators don't invest a ton of energy perusing each resume. Examination has shown that recruiting supervisors will in general go through just 6 seconds for every resume. On the off chance that your resume incorporates old or superfluous data, for example, occupations held more than 10 years prior or minor degrees and accomplishments, it might divert from significant data. </p>
<p>Attempt to incorporate just work insight, accomplishments, instruction and abilities generally pertinent to the business. You can track down the most important characteristics by intently perusing the work posting. You ought to focus on significant data higher on your resume to cause to notice key abilities and accomplishments.</p>
<h3 id="color-matters-too">Color matters too</h3>
<p><img src="https://images.unsplash.com/photo-1502691876148-a84978e59af8?ixid=MnwxMjA3fDB8MHxwaG90by1wYWdlfHx8fGVufDB8fHx8&amp;ixlib=rb-1.2.1&amp;auto=format&amp;fit=crop&amp;w=750&amp;q=80" alt /></p>
<p>The shadings you use on your resume can represent the moment of truth your application. </p>
<p>In case you're applying to a task in a conventional industry, similar to law, bookkeeping, or land, think about utilizing no shading on your resume, or utilize an expert resume shading like dull blue or green. </p>
<p>In case you're applying to a task in a more current industry like visual communication, promoting, or design, you can securely browse a more inventive shading range, however don't over-burden your resume with a few distinct tones. Utilize a couple of reciprocal tones for headers or boundaries. Your body text ought to be dark.</p>
<h3 id="spotlight-key-skills">Spotlight Key Skills</h3>
<p><img src="https://images.unsplash.com/photo-1555602278-cb0e4ab8a01a?ixid=MnwxMjA3fDB8MHxwaG90by1wYWdlfHx8fGVufDB8fHx8&amp;ixlib=rb-1.2.1&amp;auto=format&amp;fit=crop&amp;w=750&amp;q=80" alt /></p>
<p>Regardless of whether you put your abilities segment at the highest point of your resume or at the base, after your work insight, ensure the abilities you list match the necessities for the work you're applying to. Not certain what those are? Peruse the expected set of responsibilities cautiously to see which abilities, projects, and watchwords are referenced. </p>
<p>In case there's a prerequisite or duty recorded part of the set of working responsibilities that you've acted in a current or past job, it ought to be on your resume.</p>
<hr />
<p>Nowadays it's normal that you'll follow up your application with an email or call, not simply to affirm whether the business accepted your administrative work, yet additionally to ask in the event that they had any inquiries and express your craving to examine the work face to face. </p>
<p>By calling or messaging subsequent to sending your resume you are demonstrating ingenuity, determination, and a powerful urge to be their No. 1 competitor. </p>
<p>Also, on the off chance that you progress to the meeting stage, it's pleasant to send a thank you letter and emphasize your eagerness for the position on the off chance that you felt the meeting went especially well.</p>
]]></content:encoded></item><item><title><![CDATA[18 NPM Best and Underrated packages you should use in your projects]]></title><description><![CDATA[NPM bundles save us huge loads of time and exertion. Need a date library? There's a bundle for it. Need a utility library? Forget about it, simply introduce the bundle. At whatever point you need to take care of an issue with code, the odds are there...]]></description><link>https://coderwatch.com/npm</link><guid isPermaLink="true">https://coderwatch.com/npm</guid><category><![CDATA[Web Development]]></category><category><![CDATA[General Programming]]></category><category><![CDATA[General Advice]]></category><category><![CDATA[Node.js]]></category><category><![CDATA[npm]]></category><dc:creator><![CDATA[Coder Watch]]></dc:creator><pubDate>Mon, 26 Jul 2021 06:11:44 GMT</pubDate><enclosure url="https://cdn.hashnode.com/res/hashnode/image/upload/v1627105425092/0DY3lVXJh.png" length="0" type="image/jpeg"/><content:encoded><![CDATA[<p>NPM bundles save us huge loads of time and exertion. Need a date library? There's a bundle for it. Need a utility library? Forget about it, simply introduce the bundle. At whatever point you need to take care of an issue with code, the odds are there's a bundle custom-made to your requirements. </p>
<p>Here's a rundown of bundles I figure each Node.js designer should know. Treat these NPM bundles as efficient devices and wizardry pixie partners.</p>
<hr />
<h3 id="mochajshttpsmochajsorg"><a target="_blank" href="https://mochajs.org/">MochaJS</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626929420304/ix8F3F8GA.png?auto=compress" alt /></p>
<p>Mocha is a feature-rich JavaScript test framework running on Node.js and in the browser, making asynchronous testing simple and fun. </p>
<h3 id="joihttpswwwnpmjscompackagejoi"><a target="_blank" href="https://www.npmjs.com/package/joi">JOI</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626929470267/J-UiauY04.png?auto=compress" alt /></p>
<p>The most powerful schema description language and data validator for JavaScript.</p>
<h3 id="pluralizehttpsgithubcompluralspluralize"><a target="_blank" href="https://github.com/plurals/pluralize">Pluralize</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626929490015/3qMRzh-XB.png?auto=compress" alt /></p>
<p>Pluralize or singularize any word based on a count</p>
<h3 id="nodemailerhttpsgithubcomnodemailernodemailer"><a target="_blank" href="https://github.com/nodemailer/nodemailer">Nodemailer</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626929522581/d68fSa321.png?auto=compress" alt /></p>
<p>✉️ Send e-mails with Node.JS – easy as cake! </p>
<h3 id="rechartshttpsgithubcomrechartsrecharts"><a target="_blank" href="https://github.com/recharts/recharts">Recharts</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626929544959/aQ95bXo37.png?auto=compress" alt /></p>
<p>Recharts is a Redefined chart library built with React and D3.</p>
<h3 id="cheeriojshttpscheeriojsorg"><a target="_blank" href="https://cheerio.js.org/">CheerioJS</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626929889513/qb5eIJ5BU.png?auto=compress" alt /></p>
<p>Fast, flexible &amp; lean implementation of core jQuery designed specifically for the server.</p>
<h3 id="jsdomhttpsgithubcomjsdomjsdom"><a target="_blank" href="https://github.com/jsdom/jsdom">JSDOM</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626929799853/JX2tOp1UB.png?auto=compress" alt /></p>
<p>A JavaScript implementation of various web standards, for use with Node.js</p>
<h3 id="nodoisthttpsgithubcomnullivexnodist"><a target="_blank" href="https://github.com/nullivex/nodist">Nodoist</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626930375660/zHeIk5jm5.png?auto=compress" alt /></p>
<p>A node.js and npm version manager for the windows folks out there. </p>
<h3 id="chalkhttpsgithubcomchalk"><a target="_blank" href="https://github.com/chalk">Chalk</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626930447838/7A--G1Qkt.png?auto=compress" alt /></p>
<p>Terminal string styling done right</p>
<h3 id="nodemonhttpswwwnpmjscompackagenodemon"><a target="_blank" href="https://www.npmjs.com/package/nodemon">Nodemon</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626930418457/cyUzxQdBC.png?auto=compress" alt /></p>
<p><code>nodemon</code> is a tool that helps develop node.js based applications by automatically restarting the node application when file changes in the directory are detected.</p>
<h3 id="date-fnshttpsdate-fnsorg"><a target="_blank" href="https://date-fns.org/">date-fns</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931042722/Vxxfnb9R5.png?auto=compress" alt /></p>
<p><code>date-fns</code> provides the most comprehensive, yet simple and consistent toolset for manipulating JavaScript dates in a browser &amp; Node.js.</p>
<h3 id="nanoidhttpsgithubcomainanoid"><a target="_blank" href="https://github.com/ai/nanoid/">NanoID</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626930950994/E_hCYeR4p.png?auto=compress" alt /></p>
<p>A tiny (108 bytes), secure, URL-friendly, unique string ID generator for JavaScript</p>
<h3 id="browserifyhttpswwwnpmjscompackagebrowserify"><a target="_blank" href="https://www.npmjs.com/package/browserify">Browserify</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626930985497/2T3ZOegcF.png?auto=compress" alt /></p>
<p>Use a <code>node-style</code> <code>require()</code> to organize your browser code and load modules installed by npm.</p>
<p><strong>browserify</strong> will recursively analyze all the require() calls in your app in order to build a bundle you can serve up to the browser in a single <code>&lt;script&gt;</code> tag.</p>
<h3 id="debughttpsgithubcomvisionmediadebug"><a target="_blank" href="https://github.com/visionmedia/debug">Debug</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626930898882/yXfFnf--i.png?auto=compress" alt /></p>
<p>A tiny JavaScript debugging utility modelled after Node.js core's debugging technique. Works in Node.js and web browsers</p>
<h3 id="morganhttpsgithubcomexpressjsmorgan"><a target="_blank" href="https://github.com/expressjs/morgan">Morgan</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626930883214/YlFpUqy_W.png?auto=compress" alt /></p>
<p>HTTP request logger middleware for node.js</p>
<h3 id="pm2httpspm2keymetricsio"><a target="_blank" href="https://pm2.keymetrics.io/">PM2</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626930744012/cGjdKgciw.png?auto=compress" alt /></p>
<p>ADVANCED, PRODUCTION PROCESS MANAGER FOR NODE.JS, 
PM2 is a daemon process manager that will help you manage and keep your application online 24/7</p>
<h3 id="huskyhttpsgithubcomtypicodehusky"><a target="_blank" href="https://github.com/typicode/husky">Husky</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626930649919/pnoE1q64e.png?auto=compress" alt /></p>
<p>Modern native Git hooks made easy,
Husky improves your commits and more</p>
<h3 id="validatorhttpsgithubcomvalidatorjsvalidatorjs"><a target="_blank" href="https://github.com/validatorjs/validator.js">Validator</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626930492333/RKHQ6HQQjR.png?auto=compress" alt /></p>
<p>A library of string validators and sanitizers.</p>
<hr />
<p>This was our rundown of the top NPM bundles that coders and web designers can try out. We have examined both famous just as not really well known at this point powerful NPM bundles in this rundown. </p>
<p>Prior to summing up, we should disclose to you that don't pass by the fame of the NPM bundles. All things being equal, pass by your own prerequisites.</p>
]]></content:encoded></item><item><title><![CDATA[22 Top and Highest Rated UDEMY courses worth your everything]]></title><description><![CDATA[It has an incredible assortment of courses, and as the vision says anyone can be an educator since you can discover from novice courses to proficient courses and you can learn at your own speed, the site gives numerous offers and limits and a wide sc...]]></description><link>https://coderwatch.com/udemy-courses</link><guid isPermaLink="true">https://coderwatch.com/udemy-courses</guid><category><![CDATA[Web Development]]></category><category><![CDATA[General Programming]]></category><category><![CDATA[General Advice]]></category><category><![CDATA[Python]]></category><category><![CDATA[JavaScript]]></category><dc:creator><![CDATA[Coder Watch]]></dc:creator><pubDate>Sun, 25 Jul 2021 13:39:07 GMT</pubDate><enclosure url="https://cdn.hashnode.com/res/hashnode/image/upload/v1627105822289/O8wNsHxaO.gif" length="0" type="image/jpeg"/><content:encoded><![CDATA[<p>It has an incredible assortment of courses, and as the vision says anyone can be an educator since you can discover from novice courses to proficient courses and you can learn at your own speed, the site gives numerous offers and limits and a wide scope of costs which is extraordinary, likewise the interface is continually advancing and refreshing the site as time goes. </p>
<p>Everything isn't acceptable generally so Udemy has it cons as well, Since it is essentially an open stage, you can discover terrible quality in certain courses including sound and video and furthermore not really proficient courses, however close to quality issues the site gives numerous choices and it is an incredible site to learn anything you need.</p>
<p>Let's look into 22 Best, High rated and worth of your Time and Money courses. </p>
<hr />
<h3 id="deep-learning-a-ztm-hands-on-artificial-neural-networkshttpswwwudemycomcoursedeeplearning"><a target="_blank" href="https://www.udemy.com/course/deeplearning/">Deep Learning A-Z™: Hands-On Artificial Neural Networks</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931550535/2bnMCT8jD.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>This course is simply brilliant. It gives you a comprehension of different kinds of profound learning models and guides us through executing them. It is an incredible asset to have. </p>
<p>The substance in the course is very much clarified, and it is just about as effectively reasonable as a theme permits since there are quite cutting-edge and complex subjects. The extra perusing is additionally exceptionally valuable assuming you need to go more top to bottom. </p>
<p>The makers of the course breakdown everything into straightforward language making it more clear a large portion of the course even without a solid numerical foundation yet for the individuals who are keen on the science, they give definite extra readings made by them or point towards great examination papers.</p>
<h3 id="2021-complete-python-bootcamp-from-zero-to-hero-in-pythonhttpswwwudemycomcoursecomplete-python-bootcamp"><a target="_blank" href="https://www.udemy.com/course/complete-python-bootcamp/">2021 Complete Python Bootcamp From Zero to Hero in Python</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931591260/Ddq5nNo9L.png?auto=compress" alt /></p>
<p>Type: Coding </p>
<p>Jose is a brilliant instructor, The way he explains it becomes easy for learners like me who is new to this field. Python has been one of the languages which is used everywhere and there are lot of course also available, but this one sets it apart.</p>
<p>It's particularly good how many tests/ assessments there are which forces you to go back over any topics that you're not too comfortable with.
The quality of content is amazing , full in depth detail on each topics , Easy to grasp and experiment .</p>
<h3 id="the-complete-sql-bootcamp-2021-go-from-zero-to-herohttpswwwudemycomcoursethe-complete-sql-bootcamp"><a target="_blank" href="https://www.udemy.com/course/the-complete-sql-bootcamp/">The Complete SQL Bootcamp 2021: Go from Zero to Hero</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931621036/54R1Woeia.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>The course is above assumption. Every one of the essentials and construction is very clear cut straightforward, simple to helpful likewise makes you anxious to go for hands on rehearses. In general as per me the instructor cause me more to energize in the wake of sending the entire aide bit by bit. Go for the course extremely supportive and unquestionably it makes you from ZERO TO HERO</p>
<h3 id="git-complete-the-definitive-step-by-step-guide-to-githttpswwwudemycomcoursegit-complete"><a target="_blank" href="https://www.udemy.com/course/git-complete/">Git Complete: The definitive, step-by-step guide to Git</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931661124/oyACtb5EW.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>This course is stunning! I had no involvement in Git going into it yet I came out with an abundance of valuable Git information. It covers every one of the principle points exhaustively yet what makes this course stand apart is that reality that you can track so without any problem.</p>
<h3 id="php-with-laravel-for-beginners-become-a-master-in-laravelhttpswwwudemycomcoursephp-with-laravel-for-beginners-become-a-master-in-laravel"><a target="_blank" href="https://www.udemy.com/course/php-with-laravel-for-beginners-become-a-master-in-laravel/">PHP with Laravel for beginners - Become a Master in Laravel</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931691615/4lC5sxxyw.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>Assuming you need to become familiar with some programming expertise and Edwin has course for it then, at that point don't think or look for different courses. </p>
<p>Edwin is an incredible motivation. Each exercise isn't wonderful which makes this the best course. In the event that something turns out badly Edwin goes for it and tells you the best way to investigate. This assists you with learning better and see better. You learn numerous a lot a greater number of things other than Laravel.</p>
<h3 id="advanced-css-and-sass-flexbox-grid-animations-and-morehttpswwwudemycomcourseadvanced-css-and-sass"><a target="_blank" href="https://www.udemy.com/course/advanced-css-and-sass/">Advanced CSS and Sass: Flexbox, Grid, Animations and More!</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931718472/yCphqOr1X.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>Best course out there for learning CSS. Indeed, even in 2021 the ideas, information in this course is obviously better than a large portion of the courses out there. Jonas is a genuine expert, giving profound information on essentials. </p>
<p>I would prescribe to go through fundamental CSS course first prior to taking this course, in light of the fact that frequently individuals who don't have clear comprehension of essential CSS, take this course and afterward fault on showing colleague for not responding to questions. Definately look at it, obviously better than any CSS course.</p>
<h3 id="machine-learning-a-ztm-hands-on-python-and-r-in-data-sciencehttpswwwudemycomcoursemachinelearning"><a target="_blank" href="https://www.udemy.com/course/machinelearning">Machine Learning A-Z™: Hands-On Python &amp; R In Data Science</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931867309/wQf9iz4X5.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>This course is perfectly coordinated and conveyed. Kirill Eremenko and Hadelin de Ponteves are the specialists in showing the ideas. The ideas were exact in content. I completely partook in the course, and it was enjoyable. </p>
<p>Kirill instinct recordings were fresh and exact, it helps amateurs in understanding the ML ideas and make them a superior information researcher. I think, his Intuition recordings are the top clarification recordings in this field, simplifying complex points to comprehend. Furthermore, he even proposes motion pictures that gives us a thought on ML and AI prospects. <strong>SuperDataScience</strong> web recording is a gigantic advantage, it gives us the information about the latest things in Data Science field. I turned into a fan and I routinely follow it. </p>
<p>Hadelin clarification about each line of code was first class. I think, He is deliverer for the information science fledglings. He gives clarification on each line of code and its use. Best of all, he even showed us how to look on the web and distinguish the API, Libraries that is utilized in the code, which helps us in our vocations.</p>
<h3 id="vue-the-complete-guide-with-router-vuex-composition-apihttpswwwudemycomcoursevuejs-2-the-complete-guide"><a target="_blank" href="https://www.udemy.com/course/vuejs-2-the-complete-guide/">Vue - The Complete Guide (w/ Router, Vuex, Composition API)</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931888316/oO-Ja_65m.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>I haven't discovered any assets on par with this one. </p>
<p>He's very conscientious, utilizes great coding practices, and presents things in a legitimate request that forms effectively on past addresses. The talks are likewise very much named so you can undoubtedly discover and re-watch past talks or get out ahead on the off chance that you need to. These talks are exceptionally simple to watch and have covered a large portion of my Vue questions, incorporating with the Composition API. </p>
<p>He doesn't rehash the same thing superfluously like a many individuals do, and the talks are sufficiently short so you don't lose center in a talk.</p>
<h3 id="build-responsive-real-world-websites-with-html-and-csshttpswwwudemycomcoursedesign-and-develop-a-killer-website-with-html5-and-css3"><a target="_blank" href="https://www.udemy.com/course/design-and-develop-a-killer-website-with-html5-and-css3/">Build Responsive Real-World Websites with HTML and CSS</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931917835/GIJzEIQ-2.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>Despite the fact that it's obsolete, there was as yet an enormous measure of amazingly helpful data, methods, and procedures that caused me to acknowledge how little I knew. It was additionally decent that we didn't do 1,000,000 undertakings; this made it durable and simple to follow with minimal overhead, and we wound up with a pleasant venture that is really respectable and fulfilling to take a gander at. </p>
<p>I will say, nonetheless, that I may have just been agreeable toward the start of this course since I previously had a fundamental information on HTML/CSS prior to coming in.</p>
<h3 id="seo-2021-complete-seo-training-seo-for-wordpress-websiteshttpswwwudemycomcourseseo-get-to-number1-in-google-search"><a target="_blank" href="https://www.udemy.com/course/seo-get-to-number1-in-google-search/">SEO 2021: Complete SEO Training + SEO for WordPress Websites</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931944947/FuMU624Yx.png?auto=compress" alt /></p>
<p>Type: SEO</p>
<p>This course was totally astounding! Arun was incredible at clarifying all that he covered. Certainly incredible for novices as well and will make you fully aware of numerous ideas. I firmly accept that on the off chance that you take the ideas canvassed in this course and apply them, just as some experience of your own, that you can turn into an expert. </p>
<p>I will say in any case, I would have loved there to be a little area or a talk, or even a few connects to some extraordinary posts that Arun thinks fulfill every one of his guidelines.</p>
<h3 id="the-complete-nodejs-developer-course-3rd-editionhttpswwwudemycomcoursethe-complete-nodejs-developer-course-2"><a target="_blank" href="https://www.udemy.com/course/the-complete-nodejs-developer-course-2/">The Complete Node.js Developer Course (3rd Edition)</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626931979395/I7BZNzt08.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>Andrew is an incredible educator. His sentences are moderate and brief. He clarifies things out well and attempts to show you numerous methods of tackling a similar issue. </p>
<p>He didn't coat over center issues and give you a for the most part constructed application and afterward tell you the best way to wire up a couple of courses. You construct the applications starting from the earliest stage, except for the last application that you fabricate which accompanies some css so you can zero in on building a hub application as opposed to zeroing in on the plan perspective.</p>
<h3 id="an-entire-mba-in-1-courseaward-winning-business-school-profhttpswwwudemycomcoursean-entire-mba-in-1-courseaward-winning-business-school-prof"><a target="_blank" href="https://www.udemy.com/course/an-entire-mba-in-1-courseaward-winning-business-school-prof/">An Entire MBA in 1 Course:Award Winning Business School Prof</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626932005004/cvfKuvrjr.png?auto=compress" alt /></p>
<p>Type: MBA, Business</p>
<p>This is an astounding course! </p>
<p>If you are new to this theme, you can go for this course. Every one of the ideas are thought so well. Before the finish of this course you'll be sufficiently sure to apply those ML strategies yourself.</p>
<p>This course is wonderful as a starting course to ML. Heaps of code formats and pragmatic models. The instructional exercises are straightforward and follow. I like the choice to tweak video speed. The lone analysis is that I would have preferred a smidgen more hypothetical and numerical foundation (instead of just instinct). However, generally, truly fulfilled. A debt of gratitude is in order for having such incredible quality courses at a reasonable cost!</p>
<h3 id="understanding-typescript-2021-editionhttpswwwudemycomcourseunderstanding-typescript"><a target="_blank" href="https://www.udemy.com/course/understanding-typescript/">Understanding TypeScript - 2021 Edition</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626932030608/hBpU7Acrs.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>Max truly worked effectively with his courses, he generally remind individuals on the best way to do things another way, additionally continues to remind individuals that "this technique" has been educated prior. What's more, all things considered, he continue to clarify the strategy once more. So this is excellent in case you're a novice. Obviously, you need to learn Javascript first prior to doing this. </p>
<p>The cons of this course is, this is a "Amateur" to "Center" course. Max continue rehashing exactly the same thing which would appear to be repetitive in case you're really a fast student, hence making the video longer. </p>
<p>In any case, hello, assuming you're fine with that, this is the right course for you.</p>
<h3 id="seo-training-masterclass-2021-beginner-seo-to-advanced-seohttpswwwudemycomcourseseo-with-google-other-large-platforms-to-get-great-scale"><a target="_blank" href="https://www.udemy.com/course/seo-with-google-other-large-platforms-to-get-great-scale/">SEO Training Masterclass 2021: Beginner SEO To Advanced SEO</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626932059471/ZhnMuQ5wT_.png?auto=compress" alt /></p>
<p>Type: SEO</p>
<p>The course described SEO in-depth. At first, you will only wanted to learn about keywords, but you'll get a lot more from SEO. What's great about this course is that it adapts to the trends of SEO quickly.</p>
<p>The differential of this course was the focus on technical seo, especially the part where you help us understand pagespeed insights and how we may procced to correct this. this was something i've never seen on other SEO courses and its really helpful. and you focus on content more than the good practices of SEO that we may learn by ourselves easily. the content is always the king and the key to a good ranking.</p>
<h3 id="the-complete-digital-marketing-course-12-courses-in-1httpswwwudemycomcourselearn-digital-marketing-course"><a target="_blank" href="https://www.udemy.com/course/learn-digital-marketing-course/">The Complete Digital Marketing Course - 12 Courses in 1</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626932113799/vBr2rShfR.png?auto=compress" alt /></p>
<p>Type: Digital Marketing</p>
<p>It's a decent course however I would just suggest it for amateurs. It discloses more about how to make accounts as opposed to how to deal with the ones you as of now have. </p>
<p>Besides, as he for the most part shows instances of his own pages, there are less information or other data to gain from. Additionally, most recordings were a few years prior. I would recommend an update. </p>
<p>So in case you are simply beginning, I would thoroughly suggest this course. In the event that you as of now work in this field, there are numerous things you can gain from this course too. In any case, you may get exhausted with most piece of the initial material present in this course. </p>
<p>This course blew away every one of the assumptions I had for it. There is extraordinary guidance in each part and assuming you need to begin a business and need to utilize web based showcasing to advance it this course is for you. Assuming you need to get into the web based advertising business this course will give you the foundation to kick your vocation off. I can't envision a superior course to show you internet promoting.</p>
<h3 id="angular-the-complete-guide-2021-editionhttpswwwudemycomcoursethe-complete-guide-to-angular-2"><a target="_blank" href="https://www.udemy.com/course/the-complete-guide-to-angular-2/">Angular - The Complete Guide (2021 Edition)</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626932155622/WP05vB7iJ.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>This is a truly complete course; I left away feeling like I took in an enormous sum about Angular. Precise is an enormous structure/eco-framework so it's unrealistic to really leave away knowing it all. The educator gives you enough foundation, so you would then be able to return and plunge profound into spaces of relevant interest to you. You unquestionably will leave away knowing every one of the essentials. </p>
<p>The course gets somewhat thick in the "NgRx" area. In any case, through this thickness you'll get a genuine appreciation for Observables. Generally speaking an incredible course, in light of the fact that the educator gives a great deal of consideration to subtleties that assist you with learning</p>
<h3 id="learn-python-programming-masterclasshttpswwwudemycomcoursepython-the-complete-python-developer-course"><a target="_blank" href="https://www.udemy.com/course/python-the-complete-python-developer-course/">Learn Python Programming Masterclass</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626932190873/8gNSdlLXI.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>It is a decent course, with a ton of information in it. In any case, on my case, it was "Masterclass" that jab my advantage and made me pick it. Masterclass is certainly an exaggeration for this course. You learn stuff, yet with the time spent on this course I feel like I might have dominated something like a couple of parts of Python all alone. </p>
<p>Interestingly, Tim and JP update and redesign the course constantly, so better substance I generally coming, yet honestly don't anticipate dominating anything on Python in this course. </p>
<p>This is an exceptionally thorough course. The ideas are clarified well and there is a great deal if helpful data clarifying the set of experiences, shows and execution of various parts of the language. Specifically, the revised recordings toward the beginning of the course are truly extraordinary. They are broken into more modest scaled down pieces with pleasant intelligent activities to supplement the video material.</p>
<h3 id="microsoft-excel-excel-from-beginner-to-advancedhttpswwwudemycomcoursemicrosoft-excel-2013-from-beginner-to-advanced-and-beyond"><a target="_blank" href="https://www.udemy.com/course/microsoft-excel-2013-from-beginner-to-advanced-and-beyond/">Microsoft Excel - Excel from Beginner to Advanced</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626932219253/hXUJnhZRM.png?auto=compress" alt /></p>
<p>Type: Excel Skill</p>
<p>Phenomenal course that step by step begins with the nuts and bolts and moves toward the high level ideas through basic and drawing in addresses enhanced with various models for clear agreement. </p>
<p>This course instructed by Kyle Pew is an itemized, clear and far reaching course clarifying every one of the ideas from Beginner to Advanced right from the scratch. Kyle is an astonishing educator clarifying each smidgen of MS Excel in a simple way and making working in Excel such a lot of fun.</p>
<h3 id="modern-react-with-reduxhttpswwwudemycomcoursereact-redux"><a target="_blank" href="https://www.udemy.com/course/react-redux/">Modern React with Redux</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626932249429/6mBrll72s.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>Stephen is an extraordinary educator! Albeit the course is substantial on class-based segments, there is an entire area that clarifies React Hooks exhaustively. Additionally, a significant number of the remarks in the Q/A refactor Stephen's code into React Hooks, so you're not passing up anything. Stephen clarifies significant ideas so well and I'm glad to say that I feel open to utilizing React. </p>
<p>I considered this course close by other JavaScript seminars on Udemy and my recommendation is acquire a mid-level comprehension of JavaScript and afterward take this course. I accept this course is thorough, very much organized and has effectively assisted me with building illustrations with parallax impacts utilizing State and DOM Refs. I would prescribe this course to any individual who wishes to comprehend the better subtleties of React.</p>
<h3 id="the-data-science-course-2021-complete-data-science-bootcamphttpswwwudemycomcoursethe-data-science-course-complete-data-science-bootcamp"><a target="_blank" href="https://www.udemy.com/course/the-data-science-course-complete-data-science-bootcamp/">The Data Science Course 2021: Complete Data Science Bootcamp</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626932278941/LNlAkas_j.png?auto=compress" alt /></p>
<p>Type: Coding </p>
<p>The course is all around organized with extraordinary pacing. The educators go bit by bit through the whole interaction in an exceptionally careful manner. A few talks or subtleties are somewhat tedious or exceptionally essential yet that is sensible. </p>
<p>I think some about the tests were excess as they were there additional to check whether you realize the material given as opposed to really checking information and ideas. </p>
<p>Subsequent to going through numerous courses, books, online journals and completing this course, I can certainly say to any individual who is still at beginning phase to simply have LEAP OF FAITH over this course and at last it will help in making solid establishment. </p>
<h3 id="the-complete-2021-web-development-bootcamphttpswwwudemycomcoursethe-complete-web-development-bootcamp"><a target="_blank" href="https://www.udemy.com/course/the-complete-web-development-bootcamp/">The Complete 2021 Web Development Bootcamp</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626932306070/AFwLfRTcd.png?auto=compress" alt /></p>
<p>Type: Coding</p>
<p>This is an exceptionally exhaustive course that will take you from the actual rudiments of HTML and CSS to Javascript, Node.js, React, MongoDB and then some. The course is loaded with free assets giving a lot of extension to profound jumps into practically any part of the topic. Certainly, agreeable and beneficial. </p>
<p>This course is stunning. The procedure is incredible, Angela truly sees how learning works and how to make the most from the online apparatuses. I learned significantly more than I expected, about the hypothesis behind coding as well as how to actualy complete things. Other truly significant thing I learned here is the manner by which and where get informations, how to look for and read documentations.</p>
<h3 id="wordpress-for-beginners-master-wordpress-quicklyhttpswwwudemycomcoursewordpress-for-beginners-course"><a target="_blank" href="https://www.udemy.com/course/wordpress-for-beginners-course">Wordpress for Beginners - Master Wordpress Quickly</a></h3>
<p><img src="https://cdn.hashnode.com/res/hashnode/image/upload/v1626932328390/NRRPHOFjx.png?auto=compress" alt /></p>
<p>Type: WordPress</p>
<p>This is the ideal course for novices who might want to get into the essentials of WordPress. Adhering to the directions was extremely simple as the educator has a quiet and consistent speed. </p>
<p>This course assisted me with proceeding to fill a few holes and gain new information. Andy coordinated the course quite well and made the subject fascinating. The course is separated into little segments, which is advantageous assuming you need to overhaul some particular parts later.</p>
<hr />
<p>These were some courses that are high rated and most bought by students on web (mostly bought in pandemic). I hope this collection will help you to learn more. You also know courses on Udemy are always on discount, so you'll never waste your money and everything will be worth your time. The costs of the courses are in INR that is Indian currency, some people say if used VPN and buy this course you'll get for more cheap, anyway we don't endorse that. </p>
]]></content:encoded></item></channel></rss>